Recombinant Human Translocation protein SEC62 (SEC62)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human Translocation Protein SEC62

Recombinant Human Translocation protein SEC62 (SEC62) is a protein component of the SEC61 complex, which is essential for protein translocation across the endoplasmic reticulum (ER) membrane . The human SEC62 gene, located on chromosome 3q, is identified as a tumor driver gene and is frequently overexpressed in various tumors .

Structure and Function

The mammalian Sec62 protein resides in the ER membrane and contains two transmembrane helices, a short ER-lumenal loop, and two large cytosolic domains . It forms a heterodimeric complex with the Sec63 protein and transiently associates with the heterotrimeric Sec61 complex . These interactions involve a positively charged patch of amino acid residues in the N-terminal domain of Sec62, a negatively charged cluster at the C-terminus of Sec63, and the C-terminal domain of Sec62, which includes two predicted EF hands, plus the N-terminus of Sec61α .

Sec62's cytosolic interaction partners include $$Ca^{2+}$$ (likely involving the EF hands in Sec62), ribosomes, and LC3 . These interactions involve the putative EF hands, a ribosome-binding site (RBS), and a LIR-motif within the more C-terminal EF hand, which are relevant for cellular calcium homeostasis, ER protein import, and ER-phagy, respectively .

Role in Protein Translocation

Sec62 facilitates the translocation of proteins across the ER membrane . It is involved in both co-translational and post-translational translocation pathways . Studies indicate that Sec62 is particularly important for the efficient secretion of small proteins in mammalian cells, acting as a fail-safe route for small preproteins . Mutations in the N-terminal cytosolic domain of Sec62 disrupt its interaction with Sec63, leading to defects in the translocation of moderately hydrophobic transmembrane segments of both single- and multi-spanning membrane proteins .

Experiments with yeast mutants have demonstrated that a defective Sec62–Sec63 complex impairs the translocation of the C-terminus and membrane insertion of marginally hydrophobic transmembrane segments .

SEC62 in Cancer

SEC62 overexpression has been observed in a growing number of tumors .

  • Non-small cell lung cancer (NSCLC)

  • Thyroid cancer

  • Hepatocellular cancer

  • Ovarian cancer

  • Breast cancer

  • Head and neck squamous cell carcinoma (HNSCC)

  • Cervical cancer

  • Vulvar cancer

  • Atypical fibroxanthoma

  • Melanoma

  • Gastric cancer

  • Prostate cancer

SEC62 Expression and Clinicopathological Features in Colorectal Cancer (CRC)

SEC62 is upregulated in CRC, and its expression positively correlates with the prognosis of CRC patients .

TABLE 1. Correlation between Sec62 expression and clinicopathological features in CRC patients

CharacteristicsNumber of casesExpression of Sec62p value
LowHigh
Gender
Male583226
Female411527
Age
<60392118
≥60602535
Pathology grade
I-II703238
III-IV301416
Tumour size
≤5 cm362214
>5 cm642440
Depth of invasion
T2–T3682840
T4321814
Lymph node metastasis
No523022
Yes481632
AJCC stage
1–2513021
3–4491633

Note: The bold values represent $$p < 0.05$$.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
Note: While the tag type is determined during production, please specify your preferred tag type for prioritized development.
Synonyms
SEC62; TLOC1; Translocation protein SEC62; Translocation protein 1; TP-1; hTP-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-399
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MAERRRHKKRIQEVGEPSKEEKAVAKYLRFNCPTKSTNMMGHRVDYFIASKAVDCLLDSK WAKAKKGEEALFTTRESVVDYCNRLLKKQFFHRALKVMKMKYDKDIKKEKDKGKAESGKE EDKKSKKENIKDEKTKKEKEKKKDGEKEESKKEETPGTPKKKETKKKFKLEPHDDQVFLD GNEVYVWIYDPVHFKTFVMGLILVIAVIAATLFPLWPAEMRVGVYYLSVGAGCFVASILL LAVARCILFLIIWLITGGRHHFWFLPNLTADVGFIDSFRPLYTHEYKGPKADLKKDEKSE TKKQQKSDSEEKSDSEKKEDEEGKVGPGNHGTEGSGGERHSDTDSDRREDDRSQHSSGNG NDFEMITKEELEQQTDGDCEEDEEEENDGETPKSSHEKS
Uniprot No.

Target Background

Function
Recombinant Human Translocation protein SEC62 mediates the post-translational transport of precursor polypeptides across the endoplasmic reticulum (ER). It functions as a targeting receptor for small presecretory proteins with short, apolar signal peptides. SEC62 targets and positions these nascent proteins within the SEC61 translocon complex, triggering channel opening for polypeptide translocation into the ER lumen.
Gene References Into Functions

SEC62's Role in Cellular Processes and Disease:

  1. Elevated SEC62 expression in lymph node metastases of head and neck squamous cell carcinomas and cervical cancers (unknown primary) compared to primary tumors; knockdown inhibits, while overexpression stimulates, cell migration. (PMID: 28002801)
  2. High Sec62 expression correlates with dysplastic cervical lesions. (PMID: 27553742)
  3. Sec62 is a critical component in maintaining and recovering ER homeostasis. (PMID: 27749824)
  4. TLOC1 and SKIL are identified as driver genes at 3q26, suggesting potential co-amplification of cooperating genes in regions with somatic copy number gain. (PMID: 23764425)
  5. Sec62 overexpression correlates with reduced survival in non-small cell lung cancer patients. (PMID: 24304694)
  6. CK2-mediated Sec63 phosphorylation enhances Sec62 binding. (PMID: 23287549)
  7. SEC62 gene silencing inhibits the post-translational transport of small presecretory proteins into the ER. (PMID: 22375059)
  8. The Sec62-dependent translocation pathway acts as a fail-safe mechanism for efficient small protein secretion, allowing independent regulation from the signal recognition particle pathway. (PMID: 22648169)
  9. Cyclin B1 and Sec62 are potential biomarkers and therapeutic targets for HBV-related HCC recurrence post-surgery. (PMID: 22682366)
  10. SEC62 is a potential oncogene in the amplified 3q region of non-small cell lung cancer. (PMID: 22197383)
  11. Sec62 plays a crucial role in responding to thapsigargin-induced ER stress. (PMID: 21557272)
  12. SEC62 silencing inhibits tumor cell migration and invasion. SEC62 is a potential therapeutic target in various cancers. (PMID: 20669223)
  13. TLOC1/SEC62 shows high frequency (50%) of copy number gains in prostate cancer and is upregulated at the mRNA level. (PMID: 16547154)
Database Links

HGNC: 11846

OMIM: 602173

KEGG: hsa:7095

STRING: 9606.ENSP00000337688

UniGene: Hs.744859

Protein Families
SEC62 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is SEC62 and what are its primary cellular functions?

SEC62 is a membrane protein component of the translocon complex located in the endoplasmic reticulum (ER). Its primary functions include:

  • Facilitating protein translocation across the ER membrane during protein synthesis

  • Regulating ER homeostasis during stress recovery through ER-phagy mechanisms

  • Participating in calcium homeostasis within the cell

Research methodologies for studying these functions typically involve cellular fractionation to isolate ER components, co-immunoprecipitation to identify protein-protein interactions, and fluorescence microscopy to visualize SEC62 localization . The protein contains specific domains including a LIR (LC3-interacting region) that mediates interaction with autophagy machinery, which has been validated through both in silico predictions and in vitro binding assays .

How is SEC62 expression regulated in normal versus pathological conditions?

Methodological approach to studying this regulation:

  • Compare SEC62 expression levels between normal and cancerous tissues using western blotting and immunohistochemistry

  • Correlate expression with clinical outcomes through multivariate analysis

  • Implement genomic analyses to identify potential amplification events

In hepatocellular carcinoma (HCC), high expression of SEC62 has been positively correlated with surgical recurrence. Multivariate analysis has revealed that SEC62 serves as an independent prognostic factor for early recurrence in postoperative HCC patients . Similar findings have been documented in head and neck squamous cell carcinoma (HNSCC), where SEC62 amplification has been observed at both chromosomal and protein levels .

What experimental models are most effective for studying SEC62 function?

Several experimental models have proven valuable for investigating SEC62 function:

Model TypeApplicationsAdvantagesLimitations
Cell lines (HCC, HNSCC)Basic mechanistic studiesEasy to manipulate; consistent resultsMay not reflect tumor heterogeneity
SEC62 knockout linesLoss-of-function studiesClear phenotypic readoutsCompensatory mechanisms may develop
SEC62 overexpression modelsGain-of-function studiesMimics cancer stateMay cause non-physiological effects
Orthotopic murine xenograftsIn vivo metastasis studiesReflects tumor microenvironmentSpecies differences in pathways

For generating SEC62 knockout cell lines, CRISPR/Cas9 technology has been successfully employed. For example, FaDu wild type cells have been transfected with plasmids containing guide RNA targeting SEC62, followed by puromycin selection and single cell clone isolation. Knockout validation requires both DNA sequencing (NGS) and protein analysis (western blotting) .

What are the molecular mechanisms through which SEC62 promotes cancer metastasis?

SEC62 promotes cancer cell migration and invasion through multiple signaling pathways, with integrinα/CAV1 signaling being particularly well-characterized. The methodological approach to elucidate these mechanisms includes:

  • Comparative microarray analysis between SEC62 overexpression (SEC62^OE) and SEC62 knockdown (SEC62^KD) cells to identify differentially expressed genes

  • Pathway analysis to identify enriched signaling networks

  • Functional validation through rescue experiments

In HCC, SEC62 overexpression has been shown to enhance cell migration and invasion in vitro, and promote postsurgical recurrence in vivo. Mechanistically, integrinα/CAV1 signaling was identified as a target of SEC62 in regulating cell movement. The functional relationship was validated by demonstrating that overexpression of integrin α partially rescued the inhibition of cell migration induced by SEC62 knockdown .

How does SEC62 knockout affect cellular phenotypes, and what methodological considerations are important?

SEC62 knockout generates significant phenotypic alterations in cancer cells that can be experimentally measured. Key methodological considerations include:

  • Confirmation of knockout efficiency through multiple methods

  • Real-time monitoring of cellular behaviors

  • Standardization of experimental conditions across control and knockout lines

In HNSCC FaDu cells, SEC62 knockout via CRISPR/Cas9 technology resulted in:

  • Significantly reduced proliferation rates as measured by xCELLigence system (clone1: p = 0.0095; clone2: p = 3.34e-4 compared to wild type)

  • Markedly decreased migratory potential assessed using the FluoroBlok system

  • Altered response to therapeutic agents targeting SEC62-dependent pathways

The validation of SEC62 knockout requires comprehensive approaches. In the case of FaDu cells, next-generation sequencing revealed five different alleles in one clone after Cas9 activity, with the most abundant allele showing an insertion of a cytosine before the PAM sequence (36% of reads). Western blot analysis confirmed nearly undetectable SEC62 protein levels in both knockout clones (clone1: 0.04 ± 0.03; clone2: 0.03 ± 0.02 compared to wild type) .

What is the role of SEC62 in ER stress recovery and autophagy?

SEC62 plays a critical role in endoplasmic reticulum turnover during stress recovery through a specialized form of autophagy called ER-phagy. Methodological approaches to studying this function include:

  • Induction of ER stress using chemical agents (e.g., thapsigargin)

  • Monitoring ER recovery through microscopy and biochemical assays

  • Manipulation of autophagy using inhibitors (e.g., Bafilomycin A1)

  • Analysis of protein-protein interactions between SEC62 and autophagy machinery

The LC3-interacting region (LIR) in the cytosolic domain of SEC62 is crucial for this function. Research has shown that SEC62 associates with endogenous LC3-II in living cells in a LIR-dependent manner, and this association is stabilized with Bafilomycin A1 treatment. Importantly, this interaction does not require SEC63, another translocon component .

What therapeutic strategies targeting SEC62 show promise for cancer treatment?

Based on SEC62's role in promoting cancer cell proliferation and metastasis, several therapeutic approaches have been investigated:

ApproachMechanismExperimental ModelsCurrent Stage
SEC62 inhibitorsDirect targeting of protein functionCell lines, xenograftsPreclinical
Thapsigargin (TG)Disrupts SEC62-mediated Ca²⁺ homeostasisIn vitro and in vivo modelsEarly clinical investigation
Trifluoperazine (TFP)Antagonizes SEC62 functionOrthotopic HNSCC murine xenograftsPreclinical
Combined approachesSynergistic effects with conventional therapiesVarious cancer modelsExperimental

The orthotopic HNSCC murine xenograft model has proven valuable for investigating the potential anti-proliferative and anti-metastatic effects of compounds like thapsigargin (TG) and trifluoperazine (TFP) that counteract SEC62 function . These agents have shown promise in in vitro functional assays, suggesting SEC62 might be an attractive drug target for combating postsurgical recurrence in cancers with SEC62 overexpression.

What techniques are most effective for studying SEC62 protein interactions and complex formation?

Several complementary techniques have proven valuable for investigating SEC62's interactions:

  • Co-immunoprecipitation (co-IP): Effective for detecting stable protein-protein interactions

    • Successfully used to demonstrate SEC62's LIR-dependent association with endogenous LC3-II

    • Can be performed with endogenous or ectopically expressed proteins

  • Domain mapping and mutagenesis:

    • The cytosolic LIR-containing domain of SEC62 can be appended to ER membrane-anchored GFP (GFPTM62) to study specific domain functions

    • Mutation of the SEC62 LIR abolishes association with both endogenous and recombinant LC3

  • Genetic approaches:

    • Utilizing ATG7 knockout MEFs with inactive autophagy demonstrated that SEC62-LC3 interactions require functional autophagy machinery

    • SEC63 knockout models showed that SEC62's association with LC3-II does not require SEC63

  • Structural studies:

    • In silico analysis combined with in vitro binding assays have confirmed the functionality of SEC62's LIR domain

    • These approaches helped identify critical residues for protein-protein interactions

What are the optimal techniques for generating and validating SEC62 knockout cell lines?

Generating reliable SEC62 knockout cell lines requires careful methodological considerations:

  • CRISPR/Cas9 design:

    • Selection of appropriate guide RNA sequences targeting SEC62 (e.g., 5'-CTG TGG TTG ACT ACT GCA AC-3')

    • Use of established vectors like lentiCRISPRv2-puro system

    • Transfection optimization for target cell lines

  • Clone selection process:

    • Application of puromycin selection pressure (e.g., 1.5 μg/ml)

    • Single cell isolation and colony expansion

    • Multiple rounds of selection to ensure monoclonality

  • Comprehensive validation:

    • Next-generation sequencing to confirm genetic modifications

    • Western blotting to verify protein depletion

    • Functional assays to confirm phenotypic changes

In the case of FaDu cells, NGS revealed that after CRISPR/Cas9 targeting, 88.5% of analyzed reads in clone 1 differed from the reference genome, with the most common modification being a cytosine insertion before the PAM sequence. Western blot analysis confirmed that remaining SEC62 protein levels were nearly undetectable in both validated clones (0.04 ± 0.03 and 0.03 ± 0.02 compared to wild type) .

What assays are most informative for studying SEC62's role in cell migration and invasion?

Several complementary assays provide valuable insights into SEC62's role in cell motility:

AssayMeasurementAdvantagesExample Application
xCELLigence systemReal-time cell proliferationContinuous monitoring, quantitativeDemonstrated reduced proliferation in SEC62 knockout clones
FluoroBlok systemCell migration through poresQuantifiable, mimics barrier crossingShowed decreased migration in SEC62 knockout cells
Wound healing assay2D cell migrationSimple, visualizes collective migrationCommonly used for initial screening
Transwell invasion assay3D invasion through matrixMimics in vivo invasion processEvaluates matrix degradation capabilities
Orthotopic xenograft modelsIn vivo metastasisPhysiologically relevantValidated SEC62's role in tumor spread

These assays have revealed that SEC62 knockout significantly impairs both proliferation and migration of cancer cells. For instance, when comparing wild-type and SEC62 knockout FaDu cells, a pronounced reduction in migratory potential was observed and quantified by counting migrated cells in multiple fields after DAPI staining .

What are the emerging areas of investigation regarding SEC62's roles beyond the currently established functions?

Several promising research directions are emerging:

  • SEC62's role in immune evasion:

    • How SEC62 overexpression might affect tumor-immune interactions

    • Potential impact on immunotherapy response

    • Methodological approaches combining SEC62 manipulation with immune co-culture systems

  • SEC62 in therapy resistance:

    • Mechanisms by which SEC62-mediated ER homeostasis might contribute to stress adaptation

    • Potential synergistic effects of SEC62 inhibition with conventional therapies

    • Screening approaches to identify synthetic lethality partners

  • SEC62 post-translational modifications:

    • Identification of regulatory modifications affecting SEC62 function

    • Development of site-specific antibodies to track modified forms

    • Mass spectrometry-based approaches for comprehensive modification mapping

  • SEC62 in non-cancer pathologies:

    • Expanding research beyond oncology to other ER stress-related diseases

    • Studying SEC62 function in neurodegenerative conditions

    • Animal models with tissue-specific SEC62 modulation

Each of these directions requires development of new methodological approaches and experimental models to fully elucidate SEC62's complex roles in cellular biology.

How can researchers integrate multiple approaches to develop a comprehensive understanding of SEC62 biology?

Developing a complete picture of SEC62 biology requires integration of diverse research approaches:

  • Combine genetic manipulation (knockouts, mutations) with functional assays to establish causality

  • Correlate basic research findings with clinical observations to ensure relevance

  • Utilize both in vitro and in vivo models to validate key findings

  • Apply systems biology approaches to place SEC62 within broader cellular networks

  • Develop computational models to predict SEC62 behavior under various conditions

SEC62 represents an important research target with significant implications for understanding both fundamental cell biology and disease mechanisms. The protein's dual roles in protein translocation and ER-phagy position it at a critical intersection of cellular homeostasis pathways. Furthermore, its emerging functions in cancer progression make it a promising therapeutic target.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.