Recombinant Human Translocation protein SEC63 homolog (SEC63)

Shipped with Ice Packs
In Stock

Description

Introduction and Basic Properties

Recombinant Human SEC63 is a partial protein fragment (amino acids 98–181) with a molecular weight of 87,997 Da and ≥85% purity via SDS-PAGE analysis . It corresponds to the human SEC63 gene (Entrez ID: 11231; UniProt ID: Q9UGP8), encoding a protein translocation regulator involved in ER membrane dynamics . Key aliases include DNAJC23, ERdj2, and PCLD2, reflecting its roles as a DnaJ chaperone and association with polycystic liver disease .

Domain Architecture

  • J-domain: Facilitates interaction with HSPA5/BiP to drive ATP-dependent polypeptide translocation .

  • Brl domain: Cytosolic region critical for gating the Sec61 translocon .

  • Transmembrane segments: Anchor SEC63 to the ER membrane and stabilize Sec61/Sec62/Sec63 complexes .

Gene Ontology Annotations

ProcessRole of SEC63
Liver developmentMutations linked to autosomal dominant polycystic liver disease .
Post-translational ER importSubstrate-selective quantity control for multi-spanning membrane proteins .
Cotranslational transportFacilitates signal peptide recognition and Sec61 channel opening .

Key Interactions

PartnerFunction
Sec61 complexForms the core translocation pore; SEC63 binding reduces plug domain obstruction .
Sec62Stabilizes open Sec61 conformation; cooperates in substrate specificity .
HSPA5/BiPATPase activity enables polypeptide ratcheting into the ER lumen .

Overexpression and Knockdown Effects

  • Overexpression: Reduces steady-state levels of viral/cellular multi-spanning proteins (e.g., HBV.S) by ~70% .

  • Knockdown: Increases polytopic ER proteins (e.g., AQP2, ERj3) by 2–3×, indicating regulatory roles .

Substrate-Specific Transport Deficits

Affected ProteinsUnaffected Proteins
Prion protein (PrPΔHD/ΔGPI)Immunoglobulin κ light chain
Aquaporin-2 (AQP2)ERj1, calnexin, BiP
ERj3Single-span membrane proteins

Data from siRNA and knockout models show SEC63 is non-essential but selectively impacts substrates with weak signal peptides .

Implications in Disease and Therapeutic Potential

  • Polycystic Liver Disease: ~30% of cases involve SEC63 mutations disrupting polycystin-1 trafficking to primary cilia .

  • Neurodegeneration: SEC63 dysfunction impairs prion protein translocation, potentially contributing to prionopathies .

  • Cancer: Overexpression correlates with enhanced ER stress tolerance in hepatocellular carcinoma models .

Applications in Biomedical Research

  • Antibody Validation: Used as a control fragment (100× molar excess) for blocking experiments in WB/IHC .

  • Mechanistic Studies: Critical for reconstituting ER translocation assays to study Sec61 gating .

  • Drug Screening: Target for small molecules modulating ER-associated degradation (ERAD) pathways .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. If you have specific format requirements, please indicate them during order placement and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery time information.
Note: All protein shipments are standardly packaged with blue ice packs. If you require dry ice packaging, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C, and aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type in mind, please inform us and we will prioritize its development.
Synonyms
SEC63; SEC63L; Translocation protein SEC63 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-760
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
AGQQFQYDDSGNTFFYFLTSFVGLIVIPATYYLWPRDQNAEQIRLKNIRKVYGRCMWYRL RLLKPQPNIIPTVKKIVLLAGWALFLFLAYKVSKTDREYQEYNPYEVLNLDPGATVAEIK KQYRLLSLKYHPDKGGDEVMFMRIAKAYAALTDEESRKNWEEFGNPDGPQATSFGIALPA WIVDQKNSILVLLVYGLAFMVILPVVVGSWWYRSIRYSGDQILIRTTQIYTYFVYKTRNM DMKRLIMVLAGASEFDPQYNKDATSRPTDNILIPQLIREIGSINLKKNEPPLTCPYSLKA RVLLLSHLARMKIPETLEEDQQFMLKKCPALLQEMVNVICQLIVMARNREEREFRAPTLA SLENCMKLSQMAVQGLQQFKSPLLQLPHIEEDNLRRVSNHKKYKIKTIQDLVSLKESDRH TLLHFLEDEKYEEVMAVLGSFPYVTMDIKSQVLDDEDSNNITVGSLVTVLVKLTRQTMAE VFEKEQSICAAEEQPAEDGQGETNKNRTKGGWQQKSKGPKKTAKSKKKKPLKKKPTPVLL PQSKQQKQKQANGVVGNEAAVKEDEEEVSDKGSDSEEEETNRDSQSEKDDGSDRDSDREQ DEKQNKDDEAEWQELQQSIQRKERALLETKSKITHPVYSLYFPEEKQEWWWLYIADRKEQ TLISMPYHVCTLKDTEEVELKFPAPGKPGNYQYTVFLRSDSYMGLDQIKPLKLEVHEAKP VPENHPQWDTAIEGDEDQEDSEGFEDSFEEEEEEEEDDD
Uniprot No.

Target Background

Function
SEC63, a translocation protein, mediates cotranslational and post-translational transport of specific precursor polypeptides across the endoplasmic reticulum (ER). It is believed to play a supporting role in recognizing precursors with short and apolar signal peptides. SEC63 might collaborate with SEC62 and HSPA5/BiP to facilitate the targeting of small presecretory proteins into the SEC61 channel-forming translocon complex, thereby initiating channel opening for polypeptide translocation into the ER lumen. SEC63 is essential for efficient PKD1/Polycystin-1 biogenesis and trafficking to the plasma membrane of the primary cilia.
Gene References Into Functions
  1. Research suggests that a loss of PRKCSH and SEC63 results in general defects in ciliogenesis, while a suppression of the Wnt signaling cascade is specific to cholangiocytes. PMID: 28973524
  2. A germline mutation in SEC63 may contribute to cyst formation in polycystic liver disease. PMID: 23209713
  3. Phosphorylation of Sec63 by CK2 enhances its binding to Sec62. PMID: 23287549
  4. Sec63 might play a substrate-selective quantity control function during cotranslational endoplasmic reticulum import. PMID: 23166619
  5. Silencing the human SEC63 genes inhibits the transport of only a subset of signal-peptide-containing precursor proteins to the endoplasmic reticulum. PMID: 22375059
  6. Nucleoredoxin was identified as an interaction partner of Sec63; this interaction was characterized. Sec63 is linked to the Wnt signaling pathways, and this interaction may explain why mutations in SEC63 can lead to polycystic liver disease. PMID: 21251912
  7. A total of 26 novel mutations were identified in PRKCSH (n = 14) and SEC63 (n = 12), including four splice site mutations, eight insertions/deletions, six non-sense mutations, and eight missense mutations. PMID: 20095989
  8. Mutations in SEC63 cause autosomal dominant polycystic liver disease, highlighting the role of cotranslational protein-processing pathways in maintaining epithelial luminal structure and implicating noncilial ER proteins in human polycystic disease. PMID: 15133510
  9. Sec63p expression was observed in all cyst epithelia regardless of mutational state. Cystogenesis in SEC63-associated PCLD occurs through a distinct mechanism. PMID: 18224332

Show More

Hide All

Database Links

HGNC: 21082

OMIM: 608648

KEGG: hsa:11231

STRING: 9606.ENSP00000357998

UniGene: Hs.26904

Involvement In Disease
Polycystic liver disease 2 (PCLD2)
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Widely expressed, with high levels in the liver.

Q&A

What is the basic function of SEC63 in protein translocation?

SEC63 is a key component of the protein translocation machinery in the endoplasmic reticulum membrane. It primarily functions as part of the SEC62-SEC63 complex that mediates post-translational translocation of secretory proteins into the ER . The protein contains a lumenal J domain that interacts with the ER resident BiP chaperone, facilitating protein movement across or integration into the ER membrane . While initially characterized for its role in post-translational import of secretory proteins, recent evidence suggests a more complex function in regulating cotranslational processes for certain protein substrates .

How does SEC63 structure relate to its function?

SEC63 is a multi-domain membrane protein with three transmembrane segments, a cytosolic N-terminal domain, and a lumenal J domain. The J domain is particularly important as it recruits and activates the BiP chaperone through ATP hydrolysis, which provides the driving force for translocation . The cytosolic N-terminal domain interacts with SEC62, though interestingly, in human cells, SEC63 appears to function independently of this interaction in some contexts . Mutations in the J domain significantly reduce the protein's functionality, suggesting this domain is critical for SEC63-mediated regulation of protein integration .

What are the most effective methods for studying SEC63 function in cell models?

To effectively study SEC63 function, researchers typically employ a combination of approaches:

  • Gain/Loss of Function Studies: Overexpression and knockdown experiments reveal SEC63's role in regulating steady-state levels of membrane proteins .

  • Mutagenesis: Site-directed mutagenesis targeting specific domains (particularly the J domain and SEC62-interacting regions) helps identify functional motifs .

  • Protein Interaction Analysis: Co-immunoprecipitation and proximity labeling techniques detect SEC63 interactions with SEC62, BiP, and other translocon components.

  • Translocation Assays: Using reporter proteins with varying membrane topologies to assess how SEC63 affects their integration into the ER membrane .

  • Live Cell Imaging: Fluorescently tagged SEC63 helps visualize its localization and dynamics during protein translocation events.

For rigorous experimental design, including appropriate controls for SEC63 overexpression or knockdown is essential, as is the selection of diverse reporter proteins to capture substrate-specific effects.

How can researchers assess the substrate specificity of SEC63?

Determining SEC63 substrate specificity requires systematic analysis using diverse protein substrates. The following methodology has proven effective:

Experimental Approach for Assessing SEC63 Substrate Specificity:

  • Selection of Diverse Reporter Proteins:

    • Soluble secretory proteins

    • Single-spanning membrane proteins

    • Multi-spanning membrane proteins with varying topologies

    • Proteins with different hydrophobicity profiles and charged residue distributions

  • Controlled Expression Systems:

    • Inducible SEC63 expression systems

    • siRNA-mediated knockdown

    • CRISPR/Cas9 gene editing for complete knockout

  • Quantitative Analysis:

    • Steady-state protein levels measurement using western blotting

    • Pulse-chase experiments to assess protein stability

    • Subcellular fractionation to determine protein localization

  • Topological Analysis:

    • Protease protection assays

    • Glycosylation mapping

    • Crosslinking studies

Research has shown that SEC63 exhibits preferential effects on multi-spanning membrane proteins while having minimal impact on soluble and single-spanning membrane proteins . Specifically, both viral and cellular polytopic membrane proteins show reduced steady-state levels when SEC63 is overexpressed, while their levels increase upon SEC63 knockdown .

How does SEC63 regulate multi-spanning membrane protein integration?

SEC63 plays a specific regulatory role in the biogenesis of multi-spanning membrane proteins through several mechanisms:

  • Cotranslational Quality Control: SEC63 appears to modulate the steady-state levels of polytopic membrane proteins during their cotranslational integration into the ER membrane . This function is independent of its classic role in post-translational import.

  • BiP Recruitment: Through its J domain, SEC63 recruits and activates the BiP chaperone, which may assist in proper folding of membrane protein segments as they emerge from the translocon .

  • Transmembrane Domain Processing: Evidence suggests SEC63 may be particularly important for the correct topogenesis of C-terminal transmembrane domains. Mutations in SEC62 that impair SEC63 interaction lead to defects in membrane insertion and translocation of C-terminal domains .

  • Substrate-Selective Quantity Control: SEC63 appears to perform a selective regulatory function during cotranslational ER import, potentially serving as a checkpoint for certain classes of membrane proteins .

The following table summarizes the differential effects of SEC63 on various protein substrates:

Protein TypeEffect of SEC63 OverexpressionEffect of SEC63 KnockdownDependence on J Domain
Multi-spanning membrane proteinsDecreased steady-state levelsIncreased steady-state levelsHigh
Single-spanning membrane proteinsMinimal effectMinimal effectNot determined
Soluble secretory proteinsMinimal effectMinimal effectNot determined

What is the relationship between SEC63 and the SEC61 translocon?

SEC63 functions in close association with the SEC61 translocon, which forms the core channel for protein translocation across or integration into the ER membrane . Their relationship is characterized by:

  • Functional Cooperation: While SEC61 provides the primary conduit for polypeptide movement, SEC63 appears to serve as a regulatory component that influences how specific substrates interact with the translocation machinery.

  • Physical Proximity: SEC63 is thought to associate with the SEC61 complex, potentially forming a larger supercomplex during certain translocation events.

  • Substrate Handoff: For post-translational import, SEC63 may help transfer substrates to the SEC61 channel through its interaction with BiP.

  • Complementary Roles: SEC61 functions primarily as the channel, while SEC63 contributes regulatory and chaperone-recruiting activities that may be particularly important for complex membrane proteins.

Research suggests that SEC63's regulatory function on polytopic membrane proteins occurs within the context of cotranslational translocation through the SEC61 translocon, representing a previously unrecognized quality control mechanism .

How do mutations in SEC63 affect membrane protein homeostasis in disease models?

Mutations in SEC63 have been implicated in several disorders, particularly polycystic liver disease. Research into the molecular mechanisms reveals complex effects on membrane protein homeostasis:

  • Altered Substrate Processing: SEC63 mutations can disrupt the normal handling of specific membrane protein clients, potentially leading to their mislocalization or degradation.

  • ER Stress Responses: Dysfunctional SEC63 may trigger ER stress pathways due to accumulation of improperly processed membrane proteins.

  • Experimental Approaches to Study Disease Mutations:

    • Patient-derived cell lines

    • CRISPR/Cas9 knock-in of specific mutations

    • Mouse models expressing SEC63 variants

    • Proteomics to identify affected client proteins

Research indicates that J domain mutations in SEC63, which weaken its interaction with BiP, significantly reduce its capacity to regulate polytopic membrane protein levels . This suggests that the SEC63-BiP interaction is critical for proper membrane protein biogenesis and may represent a therapeutic target in SEC63-related disorders.

What are the current challenges in reconstituting SEC63 function in vitro?

Reconstituting SEC63 function in cell-free systems presents several technical challenges:

  • Membrane Environment: As a multi-spanning membrane protein, SEC63 requires a suitable lipid environment for proper folding and function.

  • Cooperative Partners: SEC63 functions within a complex network of interacting proteins, including SEC61, SEC62, and BiP, all of which may need to be present in correct stoichiometry.

  • Post-translational Modifications: Any regulatory modifications of SEC63 must be reproduced in the in vitro system.

  • Methodological Approaches:

    • Liposome reconstitution with purified components

    • Microsomal preparations retaining native ER membranes

    • Semi-permeabilized cell systems

    • Nanodiscs containing SEC63 and partner proteins

  • Activity Assays: Developing sensitive assays to measure SEC63 function, particularly its substrate-selective effects on membrane protein integration.

Researchers have had some success using microsomal preparations that retain the native translocon components, but fully reconstituted systems with purified components remain challenging due to the complexity of the machinery involved.

How might advanced imaging techniques advance our understanding of SEC63 dynamics?

Advanced imaging approaches offer promising avenues for SEC63 research:

  • Super-Resolution Microscopy: Techniques like STORM or PALM could reveal the nanoscale organization of SEC63 within the ER membrane and its dynamic redistribution during different translocation events.

  • Single-Molecule Tracking: Following individual SEC63 molecules could illuminate how they interact with different substrate proteins and partner components of the translocation machinery.

  • FRET-Based Approaches: Förster resonance energy transfer between labeled SEC63 and substrate proteins could provide real-time information about their interactions during the translocation process.

  • Cryo-Electron Tomography: This could potentially capture SEC63 in action within cellular contexts, providing structural insights into its function within the native ER environment.

  • Live-Cell Dynamics: Combining fluorescently tagged SEC63 with substrate reporters could reveal the temporal and spatial regulation of protein translocation events.

These approaches would help answer fundamental questions about how SEC63 selectively regulates certain substrates and how its activity is coordinated with other components of the translocation machinery.

What is the potential of SEC63 as a target for modulating protein biosynthesis in research applications?

The substrate-selective regulatory function of SEC63 suggests potential applications in controlling protein expression:

  • Engineered SEC63 Variants: Modified versions of SEC63 with altered substrate specificity could selectively modulate the expression of specific membrane proteins.

  • Inducible SEC63 Systems: Controllable expression of SEC63 could provide temporal regulation of membrane protein levels in experimental systems.

  • Therapeutic Potential: In disorders characterized by overexpression of certain membrane proteins, SEC63 modulation might offer a novel regulatory approach.

  • Research Applications:

    • Control systems for difficult-to-express membrane proteins

    • Tools for studying membrane protein quality control

    • Approaches for modulating specific disease-related membrane proteins

The J domain of SEC63 represents a particularly important target for modulation, as mutations in this domain significantly affect its regulatory capacity on membrane protein biogenesis .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.