Recombinant Human Translocator protein (TSPO)

Shipped with Ice Packs
In Stock

Description

Immunomodulation and Inflammation

  • Recombinant TSPO is critical for studying macrophage activation and synovial inflammation in rheumatoid arthritis (RA). TSPO expression is elevated in RA synovial fibroblasts (FLS cells) and M2 macrophages .

  • Key Finding: PET radioligands targeting TSPO (e.g., 11C-PK11195) detect synovial inflammation with 10-fold higher binding in RA patients than controls .

Apoptosis and Oxidative Stress

  • Recombinant TSPO modulates reactive oxygen species (ROS) production. Overexpression in astrocytic cells increases ROS, while TSPO antagonists (e.g., FEPPA) reverse this effect .

  • Key Finding: TSPO interacts with voltage-dependent calcium channels to regulate cardiac apoptosis and ischemic injury .

Neuroinflammation Imaging

  • TSPO-targeted PET ligands (e.g., 18F-PBR28) are used to visualize microglial activation in neurodegenerative diseases like Alzheimer’s . Neuronal activity itself upregulates TSPO, complicating its interpretation as a pure inflammation marker .

Cancer Biology

  • TSPO ligands induce apoptosis in colorectal cancer cells by reducing mitochondrial membrane potential . Recombinant TSPO aids in screening anti-cancer compounds targeting mitochondrial pathways.

Ocular and Cardiovascular Diseases

  • In glaucoma and age-related macular degeneration, recombinant TSPO helps study ROS modulation and microglial activation . TSPO ligands reduce retinal inflammation and ischemic damage .

Controversies and Limitations

  • Steroidogenesis Debate: While pharmacological studies implicate TSPO in cholesterol transport, genetic deletions show minimal impact on baseline steroidogenesis .

  • Cell-Type Specificity: TSPO is expressed in astrocytes, endothelial cells, and vascular smooth muscle cells—not just microglia . This complicates its use as a cell-specific biomarker.

Key Research Findings

Study FocusOutcomeSource
RA SynovitisTSPO PET signal correlates with activated FLS cells and M2 macrophages, not just macrophages.
Neuronal ActivityNeuronal stimulation (e.g., amphetamine) increases TSPO mRNA and protein levels in mice.
Astrocyte ReactivityLPS-induced TSPO upregulation in astrocytes increases ROS and reduces glucose uptake.
Polymorphism EffectsAla147→Thr mutation alters cholesterol binding and ligand affinity in crystal structures.

Future Directions

  • Therapeutic Targeting: Develop TSPO ligands with cell-type specificity to mitigate off-target effects in neuroinflammation .

  • Structural Studies: Resolve conformational changes in TSPO during ligand binding using recombinant protein crystallography .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we currently have in stock. However, if you have specific requirements for the format, please indicate them when placing your order, and we will prepare it according to your needs.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for the specific delivery timeframe.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require shipping with dry ice, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to collect the contents at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
TSPO; BZRP; MBR; Translocator protein; Mitochondrial benzodiazepine receptor; PKBS; Peripheral-type benzodiazepine receptor; PBR
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-169
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
APPWVPAMGFTLAPSLGCFVGSRFVHGEGLRWYAGLQKPSWHPPHWVLGPVWGTLYSAM GYGSYLVWKELGGFTEKAVVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLLLVSGAAA ATTVAWYQVSPLAARLLYPYLAWLAFTTTLNYCVWRDNHGWRGGRRLPE
Uniprot No.

Target Background

Function
Translocator protein (TSPO) is capable of binding protoporphyrin IX and potentially plays a role in the transport of porphyrins and heme. It facilitates the transport of cholesterol across mitochondrial membranes and may participate in lipid metabolism, although its exact physiological role is debated. It does not appear to be essential for steroid hormone biosynthesis. Initially identified as the peripheral-type benzodiazepine receptor, TSPO can also bind isoquinoline carboxamides.
Gene References Into Functions
  1. An increase in the expression levels of TSPO mRNA is not necessarily a reliable diagnostic biomarker in most cancers, as changes are often not significant enough to be reliably detected by in situ hybridization. PMID: 30044440
  2. Studies suggest that altered TSPO distribution in the cerebellum, and possibly other regions (e.g., the hippocampus), may serve as a marker of pathophysiology in systemic lupus erythematosus. PMID: 27387599
  3. Research explores the impact of genetic variations in the TSPO gene on protein structure and stability. PMID: 29641545
  4. A PET study observed increased TSPO availability, indicating primarily microglial activation, in the anterior cingulate cortex during moderate to severe major depressive episodes. The potential contribution of suicidality to the elevated TSPO in major depressive disorder warrants further investigation in adequately powered studies. PMID: 28939116
  5. A study found significantly lower levels of activated microglia in the brains of living alcohol-dependent individuals compared to healthy controls, as measured by [11C]PBR28 PET. Notably, exploratory analyses suggest that lower [11C]PBR28 VT values are associated with greater alcohol dependence severity and higher reported alcohol consumption per day over the previous month. PMID: 28242869
  6. Researchers investigate the function of TSPO in cholesterol efflux from retinal pigment epithelium (RPE) cells. They demonstrate that TSPO-specific ligands promote cholesterol efflux to acceptor (apo)lipoprotein and human serum, whereas TSPO loss results in impaired cholesterol efflux. PMID: 28973423
  7. Studies suggest that both p53 and TSPO, two key proteins involved in apoptosis and cancer suppression, are critically involved. PMID: 26378498
  8. Research indicates that fibromyalgia patients with the translocator protein high-affinity binding genotype reported higher pain intensity and more severe fibromyalgia symptoms compared to individuals with mixed/low affinity binders. This effect was modulated by interaction with the serotonin transporter gene. PMID: 27448744
  9. Genome-wide significant (GWS) associations in single-nucleotide polymorphism (SNP)-based tests (P < 5 x 10(-8)) were identified for SNPs in PFDN1/HBEGF, USP6NL/ECHDC3, and BZRAP1-AS1. PMID: 28183528
  10. TSPO mutations in rats and a human polymorphism impair the rate of steroid synthesis. PMID: 29074640
  11. Findings suggest lower glial density or an altered activation state with reduced TSPO expression in the hippocampus of alcohol-dependent patients. PMID: 28072413
  12. Research demonstrates a consistent down-regulation of TSPO mRNA and protein in macrophages activated to a pro-inflammatory, or 'M1' phenotype. PMID: 28968465
  13. These findings have significant implications for understanding the biology of TSPO in activated macrophages and microglia in humans. PMID: 28530125
  14. TSPO may serve a range of functions that can be viewed as downstream regulatory effects of its primary, evolutionarily conserved role in cell metabolism and energy production. PMID: 28103132
  15. This research reports, for the first time, the kinetic properties of the novel third-generation TSPO PET ligand (18)F-GE180 in humans. 2TCM4k is the optimal method for quantifying brain uptake, 90 min is the optimal scan length, and the Logan approach can be utilized to generate parametric maps. While these control subjects exhibited relatively low VT, the methodology presented forms the basis for quantification. PMID: 27261523
  16. Research demonstrates a rapid decrease in TSPO binding to the high-affinity site induced by exposure to cigarette smoke. PMID: 27939322
  17. Studies show that TSPO's mitochondrial functions include modulation of nuclear gene expression through mitochondrial-nuclear signaling. This suggests how TSPO can regulate several vital cellular functions, with major implications for the whole organism in both health and disease. PMID: 28387723
  18. TSPO is an ancient bacterial receptor/stress sensor that has evolved additional interactions, partners, and roles within its mitochondrial outer membrane environment in eukaryotes. PMID: 27074410
  19. Unlike the strictly mitochondrial localization of PBR/TSPO, PBR-S (an isoform lacking exon 2) exhibits a punctate distribution throughout the cytosol that co-localizes with lysosomes in HeLa, HEK-293, MDA-MB-231, BJ, and U87-MG cells. PMID: 28263860
  20. [(18)F]PBR102 and [(18)F]PBR111 display distinct metabolic profiles in rats and non-human primates. Radiometabolites contributed to non-specific binding and confounded in vivo brain analysis of [(18)F]PBR102 in rodents; the impact in primates was less pronounced. Both [(18)F]PBR102 and [(18)F]PBR111 are suitable for PET imaging of TSPO in vivo. In vitro metabolite studies can be used to predict in vivo radioligand metabolism. PMID: 27699720
  21. Research explores the epigenetic regulation of TSPO. PMID: 28004979
  22. The effects of PK11195 on meningioma were associated with a decrease in allopregnanolone biosynthesis, mediated by TSPO. PMID: 26835706
  23. Research demonstrates that TSPO plays an anti-inflammatory role in endothelial activation by inhibiting VCAM1 and regulating mitochondrial function in endothelial cells. PMID: 26608360
  24. This study focuses on the current understanding of the interplay between TSPO, reactive oxygen species, and the voltage-dependent anion channel to which it binds, in regulating cell mitophagy. [review] PMID: 26551691
  25. The authors discuss findings regarding TSPO and its role in steroidogenesis, which are inconclusive at this time. [Review] PMID: 26551695
  26. Studies have confirmed that TSPO expression increases with tumor grade in astrocytomas, but some overlap exists between low-grade and anaplastic lesions. PMID: 26551696
  27. This work implicates TSPO in maintaining mitochondrial membrane integrity and controlling mitochondrial ROS production, ultimately favoring tissue regeneration. PMID: 27054921
  28. Differential expression has been observed in children with allergic asthma. PMID: 25979194
  29. Research concludes that ScBsAbAgn-2/TSPO targeting of glioblastoma cell lines can be achieved in vitro and in vivo. PMID: 26898800
  30. Exposure of cells to cigarette smoke resulted in alterations in biomolecules expressed by lipid peroxidation, a reduction in TSPO binding, and depletion of mitochondrial potential. This irreversible damage was exacerbated in the presence of saliva. PMID: 25968977
  31. Studies demonstrate that TSPO is highly expressed in human glioma and correlates with grade, representing a promising target in human glioma imaging for detection and staging. PMID: 26517124
  32. Elevated microglial activity can be measured in vivo using positron emission tomography (PET) with radioligands specific for the 18 kDa translocator protein (TSPO), which is expressed on microglia. PMID: 26472628
  33. Preliminary findings suggest that TSPO brain imaging in glioblastoma may be a valuable tool for predicting tumor progression at follow-up and may be less susceptible to changes in blood-brain barrier permeability compared to (18)F-FET. PMID: 26182972
  34. Data indicate that TSPO expression is closely linked to the metabolic state of adipocytes and the differentiation of preadipocytes into white/brown adipocytes. TSPO expression may improve the metabolic status of adipocytes and regulate glucose homeostasis. PMID: 26123521
  35. Research highlights TSPO as a potential target for future investigations of antipsychotic-induced weight gain, supporting the involvement of mitochondrial membrane components in this significant treatment side effect. PMID: 25560467
  36. TSPO serves as a biomarker that can predict recovery from brain injury and myocarditis. PMID: 25123025
  37. Data indicate that variations in the translocator protein (18 kDa) (TSPO) gene affect susceptibility to atopic dermatitis (AD). PMID: 24998961
  38. This study identifies a key cholesterol binding enhancement motif in translocator protein 18 kDa. PMID: 25635829
  39. Results show that TSPO is involved in cell death induction by NH4Cl. TSPO ligands, depending on their concentration, modulate NH4Cl-induced toxicity in a bimodal manner. PMID: 24168369
  40. As demonstrated in a group of stroke and glioblastoma patients, (123)I-CLINDE SPECT can be employed for quantitative assessment of TSPO expression in vivo. PMID: 25453044
  41. It appears that 10(-5) M FGIN-1-27 reduces cell viability, cell metabolism, and mitochondrial function. PMID: 24532136
  42. TSPO expression is capable of distinguishing differences in the severity of myocarditis between male and female subjects. PMID: 24402571
  43. Increased TSPO expression and microglial activation are not associated with cocaine abuse. PMID: 25057196
  44. Data indicate that targeting 18 kDa translocator protein (TSPO) reduces macrophage lipid content and prevents macrophage foam cell formation. PMID: 24814875
  45. These findings suggest that TSPO is highly expressed in reactive retinal microglia and a promising target for controlling microglial reactivity during retinal degeneration. PMID: 24397957
  46. Both IRF-4 and IBP might be involved in the pathogenesis of psoriasis vulgaris. PMID: 22528235
  47. XBD173 blockade provides a practical method for estimating volume of distribution at steady-state (VND) for TSPO-targeting radioligands. PMID: 24643083
  48. Data indicate a nominal association between the rs6971 SNP in the TSPO gene and the diagnosis of bipolar disorder (BD). PMID: 23942012
  49. The mitochondrial TSPO protein inhibits HIV-1 envelope glycoprotein biosynthesis through the endoplasmic reticulum-associated protein degradation pathway. PMID: 24403586
  50. PET imaging with [11C]PBR28 in individuals with mild-to-moderate depression and C-reactive protein levels <5 mg/L do not show that depressed individuals have neuroinflammation or microglial activation. PMID: 23850810

Show More

Hide All

Database Links

HGNC: 1158

OMIM: 109610

KEGG: hsa:706

STRING: 9606.ENSP00000328973

UniGene: Hs.202

Protein Families
TspO/BZRP family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.
Tissue Specificity
Found in many tissue types. Expressed at the highest levels under normal conditions in tissues that synthesize steroids.

Q&A

What is TSPO and what is its cellular localization?

TSPO is an 18 kDa protein primarily localized to the outer mitochondrial membrane (OMM). Originally identified in 1977 as the peripheral binding site for benzodiazepines (hence its former name "peripheral benzodiazepine receptor"), TSPO is now recognized as an evolutionarily well-conserved protein with five transmembrane domains that exists as monomers, dimers, and polymers .

Recent structural studies using NMR and crystallography have confirmed its predicted structure and binding domains, validating the role of the cholesterol binding domain and showing that the functional TSPO likely exists as a dimer . TSPO is particularly abundant in steroid-producing cells of the adrenal and testis, though it is expressed at varying levels across many tissues .

What are the major biological functions associated with TSPO?

TSPO has been implicated in numerous cellular functions, including:

FunctionDescriptionSupporting Evidence
Cholesterol transportFacilitates cholesterol translocation into mitochondria for steroidogenesisCo-isolated with VDAC and ANT; forms part of a multiprotein complex
Steroid hormone biosynthesisInvolved in the rate-limiting step of steroidogenesisHigh abundance in steroidogenic cells; regulated by hormones
Porphyrin transportFacilitates transport of porphyrins for heme synthesisBinds endogenous ligands including porphyrins
Apoptosis regulationMay influence mitochondrial permeability transitionDrug ligands binding TSPO appear to regulate apoptosis
Cell proliferationAffects cancer cell growth and proliferationAssociated with permeability transition pore regulation
NeuroinflammationUpregulated during microglial activationUsed as a biomarker in PET imaging of neuroinflammation

These functions suggest TSPO could play significant roles in both normal physiology and pathological conditions .

What experimental approaches are most effective for studying TSPO function?

When investigating TSPO function, researchers should consider multiple complementary approaches:

  • Genetic manipulation:

    • Lentiviral vector-mediated overexpression as demonstrated in the dentate gyrus of the hippocampus

    • Gene knockout or knockdown studies to evaluate phenotypic changes

  • Pharmacological intervention:

    • Application of selective TSPO ligands (e.g., PK11195 as an antagonist)

    • Combined ligand and genetic approaches to confirm target specificity

  • Biochemical assessment:

    • Western blot analysis for protein expression quantification

    • ELISA for downstream product measurement (e.g., allopregnanolone)

  • Behavioral testing (for CNS studies):

    • Contextual freezing time

    • Light-dark transition test

    • Elevated plus maze test

It is crucial to utilize multiple approaches as there have been discrepancies between results obtained from genetic versus pharmacological studies of TSPO .

How can researchers effectively validate the specificity of TSPO ligands?

The validation of TSPO ligand specificity is critical given recent evidence that these compounds may have off-target effects or mechanisms of action independent of TSPO . A comprehensive validation approach should include:

  • Competitive binding assays to establish binding affinity and selectivity

  • Parallel studies in TSPO knockout models to identify TSPO-independent effects

  • Structural studies examining ligand-protein interactions

  • Rescue experiments combining ligands with genetic approaches (e.g., testing if PK11195 blocks the effects of TSPO overexpression)

  • Consideration of lipid bilayer incorporation, as some ligands may incorporate into mitochondrial membranes rather than exclusively binding to TSPO

Researchers should be aware that recent reports propose the existence of targets other than TSPO for these ligands .

How is TSPO used as a biomarker in neuroinflammation?

  • Expression patterns: TSPO is expressed not only in microglia but also in astrocytes, endothelial cells, and vascular smooth muscle cells

  • Radioligand evolution:

    • First generation: [11C]PK11195 and radio-labeled RO5-4864

    • Limitations: high non-specific binding due to lipophilic nature

    • Second generation: Developed to achieve higher TSPO affinity and less non-specific binding

  • Clinical applications: Successfully employed in the study of multiple neurodegenerative diseases including:

    • Multiple Sclerosis (MS)

    • Alzheimer's Disease (AD)

    • Parkinson's Disease (PD)

    • Amyotrophic Lateral Sclerosis (ALS)

  • Correlation with disease progression: In AD, [11C]PK11195 binding affinity highly correlates with the degree of disease progression

What is the role of the rs6971 polymorphism in TSPO studies?

The human single nucleotide polymorphism (SNP) rs6971, resulting in an A147T substitution, significantly impacts TSPO research:

  • Binding affinity: Affects cholesterol and specific drug ligand binding

  • Clinical relevance: Previously linked to anxiety disorders

  • PET imaging implications: Creates variable binding affinity patterns requiring genotyping of research subjects

  • Research considerations: Should be genotyped in all human studies to stratify results and avoid confounding variations in ligand binding

Current evidence suggests this polymorphism does not significantly impact TSPO mRNA or protein levels, the magnitude of glial responses, cortical thickness, or the burden of AD neuropathological changes .

What are the main controversies regarding TSPO's role in steroidogenesis?

Despite extensive research, several controversies remain regarding TSPO's precise role in steroidogenesis:

  • Mechanism disagreement: While TSPO is clearly associated with cholesterol transport into mitochondria and steroidogenesis, the precise mechanism of its involvement remains unclear

  • Genetic vs. pharmacological evidence: Recent genetic depletion studies of TSPO have yielded controversial results regarding its role in steroid and heme synthesis

  • Complex formation: TSPO has been shown to associate with cytosolic and mitochondrial proteins as part of a large multiprotein complex involved in mitochondrial cholesterol transport, but the exact composition and function of this complex remain debated

  • Independent roles of ligands: There is growing recognition that TSPO ligands may have effects independent of TSPO itself, complicating the interpretation of earlier pharmacological studies

What methodological challenges affect TSPO research interpretation?

Several methodological challenges have emerged that researchers must consider:

  • Species differences: Recent studies indicate that increased TSPO binding sites in human PET imaging may have different implications from increased TSPO expression in rodents

  • Grade of inflammation: Correlations of TSPO with neuroinflammation should be interpreted with caution, as some conditions with increased inflammatory cytokines but low-grade neuroinflammation (e.g., schizophrenia) show reduced rather than increased TSPO expression

  • Cell-type specificity: TSPO is expressed in multiple cell types including microglia, astrocytes, endothelial cells, and vascular smooth muscle cells, complicating the interpretation of imaging results

  • Overlap between disease states: There is substantial overlap of TSPO mRNA and protein levels between disease states (e.g., AD) and control subjects, limiting its diagnostic specificity

What emerging approaches might advance our understanding of TSPO function?

Several promising research directions may help resolve current controversies:

  • Structural biology approaches: Further detailed structural studies at atomic resolution from different species will provide platforms for structure-based drug development

  • Cell-type specific genetic modification: Targeted manipulation of TSPO in specific cell populations to determine cell-type specific functions

  • Advanced imaging techniques: Development of more specific PET radioligands with reduced sensitivity to the rs6971 polymorphism

  • Combined multi-omics approaches: Integration of genomics, proteomics, and metabolomics to understand TSPO's role in different contexts

  • Identification of true molecular targets: Studies aimed at identifying the authentic molecular targets of TSPO ligands to distinguish the roles of TSPO itself from its ligands

How might TSPO research translate to therapeutic applications?

Potential therapeutic applications of TSPO research include:

  • Anxiolytic treatments: TSPO stimulation has been shown to have anxiolytic effects by inducing allopregnanolone production in the brain

  • Hypogonadism: Potential for reestablishing androgen levels in hypogonadal aging animals

  • Neuroinflammation modulation: Targeting TSPO to reduce neuroinflammation in neurodegenerative diseases

  • Ocular diseases: Emerging evidence suggests therapeutic potential in various ocular conditions

  • Cancer therapeutics: Given TSPO's involvement in cell proliferation, potential applications exist in cancer treatment strategies

What controls should be included in TSPO overexpression studies?

When designing TSPO overexpression experiments, researchers should include:

  • Vector controls: Lentiviral vectors containing non-targeting negative control (Lv-NC)

  • Pharmacological validation: TSPO antagonists like PK11195 to block overexpression effects

  • Behavioral controls: Baseline measures of spontaneous locomotor activity to ensure behavioral effects are not due to general motor changes

  • Visualization confirmation: Direct visualization with fluorescence microscopy (e.g., using GFP tags) to confirm expression location and levels

  • Protein quantification: Western blot analysis to confirm increased protein expression

How should researchers approach the analysis of TSPO in post-mortem tissues?

Analysis of TSPO in post-mortem tissues requires careful methodological considerations:

  • Multiple quantification approaches:

    • Quantitative immunohistochemistry

    • Western blot analysis

    • RNA-Seq data analysis

  • Co-labeling studies to determine cell type-specific expression

  • Correlation analyses with:

    • Neuropathological measures of reactive glia

    • Disease-specific pathological changes

    • Structural changes (e.g., cortical thickness)

  • Genetic analysis of relevant polymorphisms, particularly rs6971

  • Regional comparisons (e.g., temporal neocortex versus white matter)

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.