Recombinant Human Translocon-associated protein subunit delta (SSR4)

Shipped with Ice Packs
In Stock

Description

Biological Function

SSR4 is a delta subunit of the TRAP complex, critical for:

  • Protein Translocation: Facilitates cotranslational transport of nascent polypeptides across the ER membrane .

  • Calcium Regulation: Binds calcium to maintain ER resident protein retention .

  • Quality Control: Modulates N-linked glycosylation fidelity during ER stress .

Applications in Research

Recombinant SSR4 is widely used in:

ApplicationProtocolKey Studies
Western Blot (WB)Detected at ~19 kDa using polyclonal antibodies Characterizing TRAP complex interactions
Immunohistochemistry (IHC)Localizes SSR4 in ER-rich tissues (liver, pancreas) Tissue-specific expression profiling
ELISAQuantifies SSR4 in serum or cell lysatesDiagnostic research for congenital disorders
Functional StudiesInvestigates ER stress responsesRole in glycosylation disorders

Disease Associations

SSR4 dysfunction is linked to:

DiseaseMechanismClinical Findings
Congenital Disorder of Glycosylation Type Iy (CDG-Iy)Loss-of-function mutations in SSR4 Neurological impairments, developmental delays
Colon AdenocarcinomaOverexpression correlates with tumor progressionPrognostic biomarker for immune infiltration
Fatty Liver DiseaseAltered ER stress responsesLinked to metabolic dysregulation

Research Findings

  • Genetic Mutations: Eight males with CDG-Iy harbored SSR4 mutations (4 de novo, 4 inherited) .

  • Structural Insights: The CpG island between SSR4 and IDH3G regulates bidirectional transcription despite divergent protein functions .

  • Therapeutic Targets: TRAP complex inhibition reduces ER stress in fibrosis and thrombosis models .

Technical Considerations

  • Storage: Stable at -20°C; avoid freeze-thaw cycles .

  • Buffer Compatibility: PBS with glycerol (10–50%) and urea (0.4 M) maintains solubility .

  • Limitations: Denatured forms are unsuitable for functional assays; native purification is recommended .

Future Directions

  • Mechanistic Studies: Elucidate SSR4’s role in calcium signaling and ER-associated degradation (ERAD).

  • Clinical Trials: Explore SSR4-targeted therapies for CDG-Iy and cancer .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you require a specific tag type, please inform us and we will prioritize developing it for you.
Synonyms
SSR4; TRAPD; Translocon-associated protein subunit delta; TRAP-delta; Signal sequence receptor subunit delta; SSR-delta
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
24-173
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
EACLEPQITPSYYTTSDAVISTETVFIVEISLTCKNRVQNMALYADVGGKQFPVTRGQDVGRYQVSWSLDHKSAHAGTYEVRFFDEESYSLLRKAQRNNEDISIIPPLFTVSVDHRGTWNGPWVSTEVLAAAIGLVIYYLAFSAKSHIQA
Uniprot No.

Target Background

Function
TRAP proteins are components of a complex that binds calcium to the ER membrane, thus regulating the retention of ER resident proteins.
Gene References Into Functions
  1. We have identified eight affected males with either de novo (4) or inherited (4) loss of function mutations in SSR4. PMID: 26264460
  2. Findings from this study suggest that TRAPD is a potential candidate gene whose functions may be associated with ultraviolet-induced melanomagenesis and metastasis. PMID: 15057039
Database Links

HGNC: 11326

OMIM: 300090

KEGG: hsa:6748

STRING: 9606.ENSP00000317331

UniGene: Hs.409223

Involvement In Disease
Congenital disorder of glycosylation 1Y (CDG1Y)
Protein Families
TRAP-delta family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass type I membrane protein.

Q&A

What is the basic structure and function of human SSR4?

Human SSR4 (Translocon-associated protein subunit delta) is a 173-amino acid protein that functions as a component of the TRAP (Translocon-Associated Protein) complex. The protein contains a single transmembrane domain and is predominantly localized to the endoplasmic reticulum membrane. To characterize its structure, researchers typically employ circular dichroism spectroscopy to analyze secondary structure elements, along with protease protection assays to determine membrane topology. Functional studies often involve co-immunoprecipitation experiments to identify interaction partners within the translocon complex, followed by in vitro translocation assays using semi-permeabilized cells to assess the protein's contribution to translocation efficiency.

How do you express and purify recombinant human SSR4?

Expression of recombinant human SSR4 typically utilizes bacterial expression systems for basic structural studies or mammalian expression systems for functional analyses. For bacterial expression, the coding sequence should be optimized for E. coli codon usage and cloned into vectors containing appropriate fusion tags (His6, GST, or MBP) to facilitate purification. Expression in mammalian cells (HEK293 or CHO) is recommended when post-translational modifications are crucial for function. Purification follows a standard protocol of affinity chromatography, followed by size exclusion chromatography. For membrane proteins like SSR4, detergent screening is essential to identify optimal conditions that maintain protein stability while extracting it from membranes. Common detergents include DDM, LMNG, or digitonin, which should be tested systematically using thermal shift assays to assess protein stability.

What methods are used to assess the quality of purified recombinant SSR4?

Quality assessment of purified recombinant SSR4 should employ multiple complementary techniques:

  • SDS-PAGE and Western blotting - to verify protein purity and identity

  • Size exclusion chromatography - to evaluate monodispersity and oligomeric state

  • Dynamic light scattering - to confirm homogeneity of the protein preparation

  • Circular dichroism - to verify proper folding through secondary structure analysis

  • Mass spectrometry - to confirm protein identity and assess post-translational modifications

  • Functional assays - to validate that the purified protein retains expected biological activity

For membrane proteins like SSR4, detergent selection dramatically impacts quality metrics. Systematic comparison of different detergents should be performed, with quality assessment following each purification condition.

How does SSR4 contribute to protein translocation mechanisms in the ER?

SSR4 functions within the TRAP complex to facilitate translocation of specific substrate proteins. To investigate its precise role, researchers should employ a combination of approaches:

  • Crosslinking studies: Using photo-activatable or chemical crosslinkers positioned at various domains of SSR4 to capture transient interactions with nascent chains during translocation.

  • Reconstitution experiments: Assembling defined translocation complexes in proteoliposomes with and without SSR4 to assess substrate-specific effects.

  • CRISPR-mediated genome editing: Creating SSR4 knockout or conditional knockdown cell lines, followed by quantitative proteomics to identify affected client proteins.

  • Domain mapping: Generating truncation or point mutants to identify regions essential for interaction with other translocon components or specific substrate classes.

Recent findings suggest that SSR4, like its fungal counterparts, may participate in regulatory functions beyond simple mechanical aspects of translocation. This hypothesis can be tested through ribosome profiling in SSR4-depleted cells to identify translational effects on specific mRNA subsets .

What interaction partners of SSR4 have been identified and how can novel interactions be discovered?

Known interaction partners of SSR4 include other TRAP complex components (SSR1, SSR2, and SSR3), as well as Sec61 complex members. To identify novel interactions:

ApproachAdvantagesLimitationsConsiderations
BioID proximity labelingCaptures weak/transient interactionsPotential false positivesRequires careful controls and statistical analysis
Co-immunoprecipitation with mass spectrometryDirect evidence of physical interactionMay miss transient interactionsUse crosslinking to stabilize transient complexes
Split-GFP complementationIn vivo validationLimited to binary interactionsTest multiple orientations of fusion proteins
Cryo-EM analysisStructural context of interactionsRequires stable complexesConsider GraFix method to stabilize complexes

Verification of identified interactions should include reciprocal co-immunoprecipitation, functional validation through mutational analysis, and assessment of co-localization by super-resolution microscopy. Comparative analysis with fungal SSR4 orthologs suggests potential roles in regulatory complexes beyond the canonical translocon, a hypothesis worth exploring in human cells .

How can SSR4 mutations be generated and screened for functional characterization?

Systematic mutagenesis approaches for SSR4 functional analysis include:

  • Alanine scanning mutagenesis: Substituting conserved residues with alanine to identify functionally important amino acids. Prioritize residues based on evolutionary conservation across species.

  • Domain swapping: Replacing domains of human SSR4 with corresponding regions from other species to identify species-specific functions.

  • CRISPR-Cas9 base editing: For introducing specific point mutations in the endogenous SSR4 gene without disrupting the reading frame.

  • Selection-based screening: Developing reporter systems where cellular growth or fluorescence depends on functional SSR4.

Functional screening should employ readouts including:

  • Cell viability in SSR4-null backgrounds

  • ER stress markers (XBP1 splicing, ATF6 cleavage, PERK phosphorylation)

  • Secretory pathway function (using secreted luciferase reporters)

  • Substrate-specific translocation efficiency (using split GFP reporters)

Fungal studies of SSR4 demonstrate critical roles in growth and differentiation that may have parallels in specialized human cell types, suggesting screening for cell-type specific phenotypes is warranted .

What are the optimal conditions for studying SSR4 interactions with the translocon complex?

Investigating SSR4 interactions with the translocon complex requires carefully optimized experimental conditions:

  • Buffer composition:

    • Use physiological pH (7.2-7.4)

    • Include 150-300 mM KCl or NaCl to maintain ionic strength

    • Add 1-5 mM MgCl₂ to stabilize ribosome interactions

    • Include appropriate detergent (0.1% digitonin or 0.05% LMNG are preferred)

    • Consider adding 10% glycerol as a stabilizing agent

  • Temperature considerations:

    • Perform binding assays at 30°C to balance between physiological conditions and complex stability

    • For structural studies, conduct experiments at 4°C to minimize protein degradation

  • Crosslinking strategy:

    • DSS or BS3 (8-12 Å spacer arm) for general protein-protein interactions

    • Photo-activatable crosslinkers for capturing transient interactions

    • Site-specific crosslinkers incorporated via amber suppression for precise interaction mapping

  • Detection methods:

    • Use epitope-tagged variants verified to maintain functionality

    • Consider split reporter systems (split luciferase/GFP) for in vivo interaction studies

    • Apply FRET-based approaches for analyzing dynamics of interactions

Comparative analysis with fungal SSR4 interactions suggests conserved association with chromatin-remodeling complexes, which should be investigated in mammalian systems using similar methodological approaches .

How can post-translational modifications of SSR4 be analyzed comprehensively?

A comprehensive analysis of SSR4 post-translational modifications requires a multi-faceted approach:

  • Sample preparation strategies:

    • Immunoprecipitate endogenous SSR4 from various cell types and conditions

    • Express tagged SSR4 in relevant cell lines with and without stimuli

    • Isolate ER-enriched fractions to obtain context-relevant modifications

  • Mass spectrometry approaches:

    • Use complementary fragmentation methods (CID, ETD, HCD) for comprehensive coverage

    • Employ enrichment strategies for specific modifications (TiO₂ for phosphorylation, lectin affinity for glycosylation)

    • Implement parallel reaction monitoring for targeted quantification of specific modified peptides

  • Modification-specific validation:

    • Phosphorylation: Phospho-specific antibodies, Phos-tag gels, λ-phosphatase treatment

    • Ubiquitination: Ubiquitin remnant antibodies, deubiquitinating enzyme treatment

    • Glycosylation: PNGase F treatment, metabolic labeling with modified sugars

  • Functional correlation:

    • Generate non-modifiable mutants (S/T→A for phosphorylation, K→R for ubiquitination)

    • Create phosphomimetic mutants (S/T→D/E) to simulate constitutive phosphorylation

    • Assess impact on localization, interaction network, and substrate processing

Based on studies of fungal SSR4, examination of modifications affecting nuclear localization and chromatin interaction should be prioritized, as these regulatory mechanisms may be conserved in human cells .

What techniques are most effective for studying the topology and membrane integration of SSR4?

Determining the precise membrane topology of SSR4 requires multiple complementary approaches:

  • Computational prediction:

    • Use multiple algorithms (TMHMM, Phobius, TOPCONS) to generate initial topology models

    • Validate predictions against evolutionary conservation patterns

  • Biochemical mapping:

    • Cysteine accessibility method: Introduce cysteine residues throughout SSR4 and assess accessibility to membrane-impermeable thiol-reactive reagents

    • Glycosylation mapping: Insert glycosylation sites at various positions and determine which become glycosylated (indicating luminal localization)

    • Protease protection assays: Treat microsomes with proteases and identify protected fragments

  • Fluorescence-based approaches:

    • Split GFP complementation: Fuse fragments to SSR4 domains and GFP fragments targeted to specific compartments

    • Environment-sensitive fluorophores: Attach environment-sensitive dyes to specific positions and monitor spectral shifts

  • Structural methods:

    • Cryo-EM of the TRAP complex to visualize SSR4 in its native environment

    • Solid-state NMR using selectively labeled amino acids to determine orientation relative to the membrane

The resulting topology model should be integrated with crosslinking data to build a comprehensive structural model of SSR4 within the translocon complex.

How should contradictory data regarding SSR4 function be reconciled?

When encountering contradictory data regarding SSR4 function, implement this systematic reconciliation framework:

  • Methodological assessment:

    • Compare experimental systems (cell types, expression levels, tags/fusion proteins)

    • Evaluate assay sensitivities and dynamic ranges

    • Assess time scales of measurements (acute vs. chronic manipulations)

  • Context dependency analysis:

    • Test whether contradictions depend on cell type or physiological state

    • Investigate potential regulatory mechanisms that could explain context-dependent functions

    • Examine substrate-specific effects that may appear contradictory when generalized

  • Resolution strategies:

    • Perform side-by-side comparisons using standardized protocols

    • Develop quantitative models incorporating multiple functions

    • Design experiments specifically addressing the apparent contradiction

    • Consider kinetic aspects that may explain different steady-state observations

  • Experimental validation:

    • Generate SSR4 variants specifically designed to separate different proposed functions

    • Use acute inducible systems to distinguish primary from adaptive effects

    • Combine loss- and gain-of-function approaches

Studies in fungi have revealed dual roles of SSR4 in chromatin remodeling and cellular differentiation, suggesting human SSR4 may similarly possess context-dependent functions that could appear contradictory when studied in isolation .

What statistical approaches are appropriate for analyzing large-scale proteomic data involving SSR4?

For large-scale proteomic analyses of SSR4-related datasets:

  • Quality control metrics:

    • Assess sample preparation reproducibility using correlation analysis between replicates

    • Evaluate mass spectrometry data quality through identification rates and missed cleavage frequencies

    • Implement batch correction if experiments span multiple days or instrument runs

  • Differential expression analysis:

    • For normally distributed data: Student's t-test with multiple testing correction

    • For complex experimental designs: ANOVA or mixed-effects models

    • For non-parametric approaches: rank-based methods (Wilcoxon, Kruskal-Wallis)

    • Recommend minimum of 4 biological replicates for sufficient statistical power

  • Network and pathway analysis:

    • Enrichment testing against functional databases (GO, KEGG, Reactome)

    • Protein-protein interaction network construction using experimentally validated interactions

    • Implementation of systems biology approaches (WGCNA, Bayesian networks)

  • Visualization approaches:

    • Volcano plots for highlighting significant changes

    • Heatmaps with hierarchical clustering for pattern identification

    • Principal component analysis for sample relationship visualization

    • Network diagrams for contextualizing SSR4 within broader interaction landscapes

Analysis TypeRecommended ToolsKey ParametersOutput Interpretation
Differential abundanceDEP, Perseus, MSstatsFDR < 0.05, log₂FC > 1Lists of significantly changed proteins
Pathway enrichmentGSEA, enrichR, g:ProfilerAdjusted p-value < 0.05Overrepresented pathways and processes
Interaction networkSTRING, CytoscapeConfidence score > 0.7Network modules and hub proteins
Co-expression analysisWGCNASoft threshold power based on scale-free topologyCo-regulated protein modules

Fungal SSR4 studies have demonstrated regulation of nearly one-fourth of all genes, suggesting similarly broad effects might be observed in human cells when analyzing the impact of SSR4 perturbation .

How can researchers distinguish direct versus indirect effects of SSR4 manipulation in cellular systems?

Distinguishing direct from indirect effects of SSR4 manipulation requires a multi-layered experimental approach:

  • Temporal analysis:

    • Implement time-course experiments to identify earliest changes (likely direct)

    • Use inducible systems (Tet-On/Off, auxin-inducible degron) for acute manipulation

    • Apply kinetic modeling to distinguish primary, secondary, and tertiary effects

  • Proximity-based approaches:

    • Employ BioID, APEX, or TurboID proximity labeling to identify proteins in spatial proximity to SSR4

    • Implement crosslinking mass spectrometry (XL-MS) to capture direct binding partners

    • Use FRET sensors to detect direct interactions in living cells

  • Substrate identification:

    • Develop substrate trapping mutants to capture transient interactions

    • Implement RNA-protein crosslinking to identify directly bound RNAs

    • Use selective ribosome profiling to identify mRNAs whose translation depends on SSR4

  • Complementation experiments:

    • Rescue with wild-type versus mutant SSR4 variants

    • Perform domain-specific complementation to map functions

    • Use orthologous SSR4 proteins from other species to identify conserved direct effects

For integration of these approaches, create causality networks that explicitly model direct interactions versus downstream consequences, assigning confidence scores based on experimental evidence types.

How might SSR4 function be implicated in disease mechanisms?

SSR4 dysfunction may contribute to disease through several mechanisms:

  • Congenital disorders of glycosylation:

    • SSR4 mutations may impair translocation of glycosylation enzymes

    • Diagnostic approaches: N-glycan profiling, exome sequencing of patients

    • Experimental strategies: Glycoproteomic analysis in patient-derived cells, CRISPR-engineered models of patient mutations

  • Protein misfolding disorders:

    • SSR4 deficiency could impair proper folding of secretory pathway clients

    • Investigation methods: ER stress marker analysis, aggregation-prone protein reporters

    • Rescue strategies: Chemical chaperones, targeted induction of complementary translocon components

  • Cancer biology:

    • Altered SSR4 expression in tumors may modify cellular secretome

    • Analysis approaches: Cancer genome/transcriptome database mining, secretome analysis of matched normal/tumor samples

    • Therapeutic potential: Targeting SSR4-dependent secretion of pro-tumorigenic factors

  • Immune system disorders:

    • Impaired translocation of immune receptors and cytokines

    • Study designs: Immune cell-specific conditional knockout models, cytokine secretion profiling

    • Clinical correlations: Examination of SSR4 variants in immunodeficiency cohorts

Studies in fungi have shown SSR4's importance in pathogenicity mechanisms, suggesting potential parallel roles in human pathogen-host interactions that merit investigation in infectious disease contexts .

What emerging technologies will advance our understanding of SSR4 biology?

Emerging technologies with high potential for advancing SSR4 research include:

  • Cryo-electron tomography:

    • Application: Visualizing native translocon complexes within cellular context

    • Advantages: Preserves cellular environment, captures different functional states

    • Implementation strategy: Correlative light and electron microscopy to identify SSR4-enriched regions

  • Single-molecule techniques:

    • FRET-based approaches to monitor conformational changes during translocation

    • Optical tweezers to measure forces during protein translocation

    • Single-molecule tracking to analyze diffusion and clustering behaviors

  • Genome engineering advances:

    • Prime editing for precise modification without double-strand breaks

    • Base editing for introducing specific point mutations

    • CRISPR interference/activation for temporal control of expression

  • Spatial transcriptomics and proteomics:

    • Proximity-specific ribosome profiling to identify locally translated mRNAs

    • Spatial proteomics to map SSR4-dependent changes in protein localization

    • Single-cell approaches to capture cell-to-cell variation in SSR4 function

  • Computational approaches:

    • AlphaFold2/RoseTTAFold for structure prediction of SSR4 complexes

    • Molecular dynamics simulations of SSR4 within membrane environment

    • Systems biology modeling of translocon dynamics

These technologies should be integrated with findings from model organisms, including fungi where SSR4 has been shown to regulate nearly one-fourth of all genes in the genome .

How can high-throughput screening approaches be optimized for studying SSR4 substrate specificity?

Optimizing high-throughput screening for SSR4 substrate specificity requires thoughtful design:

  • Reporter system development:

    • Split fluorescent/luminescent proteins that assemble only upon successful translocation

    • Secreted enzymes whose activity can be measured in culture supernatants

    • FRET-based sensors that detect conformational changes during translocation

  • Library design strategies:

    • Synthetic signal sequence libraries with systematic variations

    • Natural protein libraries representing diverse secretory pathway clients

    • Domain-swapped chimeric proteins to map specificity determinants

  • Screening platforms:

    • Arrayed screening in multiwell format for detailed quantitative analysis

    • Pooled screening with barcode readout for higher throughput

    • Microfluidic approaches for single-cell resolution and reduced reagent consumption

  • Data analysis framework:

    • Machine learning algorithms to identify sequence/structural features determining SSR4 dependency

    • Network analysis to cluster substrates with similar dependencies

    • Integration with structural models to predict interaction interfaces

Screening ApproachThroughputResolutionKey Considerations
Flow cytometry sortingHigh (10⁶-10⁷ cells)Single-cellRequires fluorescent readout
Automated microscopyMedium (10³-10⁴ conditions)SubcellularEnables spatial information
Secretome mass spectrometryMedium (10²-10³ conditions)Proteome-wideQuantitative but indirect
Ribosome profilingLow-Medium (10-10² conditions)Transcriptome-wideCaptures translational effects

For validation, selected candidates should be tested with complementary approaches, including in vitro translocation assays and detailed biochemical characterization of the SSR4-substrate interaction.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.