Recombinant Human Transmembrane 4 L6 family member 18 (TM4SF18)

Shipped with Ice Packs
In Stock
Cat. No.
BT2137186
Source
in vitro E.coli expression system
Synonyms
TM4SF18; Transmembrane 4 L6 family member 18
Quick Inquiry

Description

Cancer Biology and Metastasis

TM4SF18 is implicated in gastric cancer (GC) progression:

  • Overexpression: Elevated in GC tissues vs. adjacent normal tissues, correlating with poor differentiation, lymph node metastasis, and advanced TNM stages .

  • Functional Impact: Knockdown reduces GC cell proliferation, migration, invasion, and EMT markers (e.g., reduced N-cadherin, vimentin) .

  • Prognostic Value: High expression predicts poor survival (Kaplan-Meier analysis) .

Diagnostic Potential

  • ROC Analysis: TM4SF18 shows diagnostic accuracy for GC (AUC = 0.786) .

  • Biomarker Utility: Dynamic monitoring of TM4SF18 levels may aid in prognosis and treatment monitoring .

Immune Microenvironment Interactions

TM4SF18 inversely correlates with immune cell markers (e.g., CD8+ T cells, macrophages) and pathways (e.g., IFN-γ), suggesting it suppresses antitumor immunity . This association may explain reduced responses to immune checkpoint inhibitors in TM4SF18-high tumors .

Challenges and Considerations

  • Post-Translational Modifications: Recombinant TM4SF18 may lack glycosylation when expressed in prokaryotic systems, affecting functional studies .

  • Immune Suppression: High TM4SF18 expression may limit therapeutic efficacy of immunotherapies, necessitating combination strategies .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
TM4SF18; Transmembrane 4 L6 family member 18
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-201
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
TM4SF18
Target Protein Sequence
MGSRKCGGCLSCLLIPLALWSIIVNILLYFPNGQTSYASSNKLTNYVWYFEGICFSGIMM LIVTTVLLVLENNNNYKCCQSENCSKKYVTLLSIIFSSLGIAFSGYCLVISALGLVQGPY CRTLDGWEYAFEGTAGRFLTDSSIWIQCLEPAHVVEWNIILFSILITLSGLQVIICLIRV VMQLSKILCGSYSVIFQPGII
Uniprot No.
Q96CE8

Target Background

Database Links

HGNC: 25181

KEGG: hsa:116441

UniGene: Hs.22026

Protein Families
L6 tetraspanin family
Subcellular Location
Membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Category

Service

THE BIOTEK
THE BioTek is a global biotech company offering highly purified proteins for research in cancer, apoptosis, development, endocrinology, immunology, neuroscience, proteases, and stem cells.
  • Contact
  • Address: 1925 E Maple Ave, El Segundo, CA 90245 United States
  • Phone : +1 201-285-7826
  • Email : info@thebiotek.com
  • Hours : Mon.-Fri. 9:00 AM - 5:00 PM
© Copyright 2025 TheBiotek. All Rights Reserved.