Recombinant Human Transmembrane 4 L6 family member 1 (TM4SF1)

Shipped with Ice Packs
In Stock

Description

Production and Quality Control

Recombinant TM4SF1 is produced under stringent conditions to ensure biological activity:

  • Expression System: HEK293 cells, chosen for their ability to perform mammalian glycosylation .

  • Purity: >95% as verified by HPLC and SDS-PAGE .

  • Activity: Validated via ELISA, with an EC50 of 6.3 ng/ml for antibody binding .

  • Endotoxin Levels: <1 EU/μg, ensuring suitability for in vitro and in vivo studies .

Role in Cancer Signaling Pathways

Recombinant TM4SF1 has been instrumental in elucidating mechanisms such as:

  • PI3K/AKT/mTOR Pathway Activation: Overexpression promotes anti-apoptotic effects via Bcl2 upregulation and Bax suppression in breast and gastric cancers .

  • JAK2/STAT3 Pathway: Collaborates with DDR1 and syntenin-2 to drive metastasis in breast cancer .

  • EMT Induction: Enhances invasion in prostate and pancreatic cancers by upregulating MMP-2/MMP-9 .

Table 2: Functional Insights from Recombinant TM4SF1 Studies

Cancer TypeKey FindingReference
Pancreatic CancerSilencing TM4SF1 increases migration/invasion and chemosensitivity .
Breast CancerCorrelates with HER-2 subtypes; regulates PI3K/AKT pathway in TNBC .
Prostate CancerAndrogen receptor (AR)-driven expression linked to metastasis .
Bladder CancerPromotes proliferation via cyclin D1/PCNA upregulation .

Therapeutic Development

Recombinant TM4SF1 is critical for preclinical studies targeting:

  • Antibody-Based Therapies: Monoclonal antibodies (e.g., clone 6B3) inhibit angiogenesis by blocking VEGF-A signaling .

  • CAR-T Cell Therapy: TM4SF1-CAR-T cells exhibit specific cytotoxicity against TM4SF1-positive tumors (e.g., ovarian SKOV3), achieving 90% remission in murine models .

  • Drug Resistance Studies: TM4SF1 knockdown sensitizes pancreatic cancer cells to capecitabine .

Challenges and Future Directions

While recombinant TM4SF1 has advanced cancer research, challenges remain:

  • Structural Complexity: Membrane localization complicates in vitro activity assays .

  • Therapeutic Specificity: Off-target effects in CAR-T therapies require further optimization .

  • Clinical Translation: No therapies have yet passed Phase III trials despite promising preclinical data .

Future studies will focus on crystallography for drug design and combination therapies targeting TM4SF1-interacting pathways (e.g., integrins, DDR1) .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a particular tag, please inform us for preferential development.
Synonyms
M3S1; Membrane component chromosome 3 surface marker 1; T4S1_HUMAN; TAAL6; Tm4sf1; Transmembrane 4 L6 family member 1; Tumor-associated antigen L6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-202
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MCYGKCARCIGHSLVGLALLCIAANILLYFPNGETKYASENHLSRFVWFFSGIVGGGLLM LLPAFVFIGLEQDDCCGCCGHENCGKRCAMLSSVLAALIGIAGSGYCVIVAALGLAEGPL CLDSLGQWNYTFASTEGQYLLDTSTWSECTEPKHIVEWNVSLFSILLALGGIEFILCLIQ VINGVLGGICGFCCSHQQQYDC
Uniprot No.

Target Background

Gene References Into Functions

TM4SF1 Function and Related Research:

  1. A novel regulatory pathway involving TM4SF1, DDR1, MMP2, and MMP9 promotes invadopodia formation and function, supporting cell migration and invasion in pancreatic cancer. (PMID: 28368050)[Link]
  2. PPARγ-SIRT1 feedback loop regulates TM4SF1 expression in bladder cancer cells. (PMID: 29175458)[Link]
  3. TM4SF1 is a direct target of miR-520f in hepatocellular carcinoma (HCC), with upregulated expression inversely correlated with miR-520f. (PMID: 29505836)[Link]
  4. miR-30a regulates TM4SF1, VEGF, and E-cadherin in colorectal cancer (CRC) lymph node metastasis, suggesting a potential therapeutic target. (PMID: 28528497)[Link]
  5. High TM4SF1 expression is associated with esophageal cancer. (PMID: 27974706)[Link]
  6. Replacing the TM4SF1 or TM4SF4 C-terminus with that of TM4SF5 enhances spheroid growth, migration, and invasion in 3D collagen gels. (PMID: 28129652)[Link]
  7. TM4SF1 expression is elevated in pancreatic cancer tissues and cell lines compared to controls. (PMID: 27459514)[Link]
  8. miR-9 directly targets TM4SF1 3'-UTR, regulating CRC cell migration and invasion. (PMID: 26983891)[Link]
  9. TM4SF1 is highly expressed in pancreatic cancer cells and increases gemcitabine chemoresistance, making it a potential therapeutic target. (PMID: 26709920)[Link]
  10. TM4SF1 overexpression enhances MDA-MB-231 cell migration but reduces apoptosis. (PMID: 26464650)[Link]
  11. High TM4SF1 expression is associated with better prognosis in pancreatic cancer, while its loss contributes to invasion and migration. (PMID: 26035794)[Link]
  12. miR-203 negatively regulates SFRP4 and positively regulates TM4SF1. (PMID: 25872484)[Link]
  13. TM4SF1 expression in gliomas may predict prognosis. (PMID: 25855954)[Link]
  14. TM4SF1 is a potential target for cancer therapy using antibody-bound toxins. (PMID: 26241677)[Link]
  15. TM4SF1 regulates cell motility and proliferation and may be a vascular therapeutic target in cancer. (PMID: 24986520)[Link]
  16. High TM4SF1 expression is associated with pancreatic cancer. (PMID: 24285464)[Link]
  17. TM4SF1 initiates nanopodia formation and facilitates cell polarization and migration. (PMID: 21626280)[Link]
  18. ARHGDIA, COBLL1, and TM4SF1 are negative regulators of apoptosis in tumor cells. (PMID: 21569526)[Link]
  19. Knockdown of TM4SF1 inhibits prostate cancer cell metastasis. (PMID: 21656834)[Link]
  20. TM4SF1 is a surface marker for mesenchymal stem cells (MSCs). (PMID: 20486778)[Link]
  21. TM4SF1 may play a role in cancer invasion and metastasis. (PMID: 12855661)[Link]
  22. TM4SF1 influences cell motility by regulating surface presentation and endocytosis of cellular components. (PMID: 18270265)[Link]
  23. TM4SF1 gene ratio is a robust predictor of survival in malignant pleural mesothelioma. (PMID: 19401544)[Link]
Database Links

HGNC: 11853

OMIM: 191155

KEGG: hsa:4071

STRING: 9606.ENSP00000304277

UniGene: Hs.351316

Protein Families
L6 tetraspanin family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Highly expressed in lung, breast, colon and ovarian carcinomas. It is also present on some normal cells, endothelial cells in particular.

Q&A

What is the molecular structure of TM4SF1?

TM4SF1 consists of four transmembrane domains (TM1-4), N-terminal and C-terminal intracellular domains, and two extracellular domains: a small domain EC1 located between TM1 and TM2, and a larger domain EC2 between TM3 and TM4 containing three α-loops (A, B, and E) and a variable domain. The C-terminal cytoplasmic portion contains an unconventional PDZ-domain-binding motif (X-Tyr-X-Cys) that can interact with syntenin-2 and activate syntenin-1, participating in cancer cell proliferation and migration . The full-length human TM4SF1 protein comprises 202 amino acids .

What cellular functions does TM4SF1 regulate under normal physiological conditions?

TM4SF1 is a plasma membrane glycoprotein that regulates cell motility and proliferation under normal conditions . It impacts the organization of lipid rafts, facilitating cell signaling pathways essential for cell growth and survival . TM4SF1 is expressed at low to moderate levels in various normal human and mouse tissues, including endothelium, skin, lung, and germ cells, where it functions to transmit extracellular signals into the cytoplasm .

What are the known aliases and classification of TM4SF1?

TM4SF1 is also known as tumor-associated antigen L6 (TAAL6), Membrane component chromosome 3 surface marker 1 (M3S1), and is classified as belonging to the L6 tetraspanin family . It was first identified in spleen tissue of lung cancer by Hellstrom in 1986 and first cloned and characterized by Marken in 1992 .

What are the validated methods for detecting TM4SF1 expression in tissue samples?

Researchers can employ several validated techniques for detecting TM4SF1:

  • Immunohistochemistry (IHC): This technique effectively visualizes TM4SF1 expression patterns in tumor and normal tissues, as demonstrated in studies across 16 cancer types .

  • Flow Cytometry: This method allows quantitative assessment of TM4SF1 expression at the cellular level, facilitating identification of TM4SF1-high versus TM4SF1-low populations .

  • Western Blotting: For protein-level quantification, particularly when assessing activation of downstream pathways .

  • RT-PCR/RNA-Seq: Transcriptomic analysis reveals TM4SF1 mRNA expression levels, useful for large-scale studies as seen in the analysis of PAH patient samples .

How can researchers effectively isolate and purify recombinant TM4SF1 protein?

Recombinant human TM4SF1 can be expressed in HEK 293 cells to ensure proper folding and post-translational modifications. The full-length protein (amino acids 1-202) can be produced with high purity (>95%) and low endotoxin levels (<1 EU/μg) . When designing expression constructs, researchers should consider that TM4SF1 is a membrane protein with four transmembrane domains, which may present challenges for solubility and functional conformation. Purification typically involves affinity chromatography followed by size exclusion techniques to ensure protein homogeneity and biological activity.

What experimental models are most suitable for studying TM4SF1 function in cancer?

Several validated experimental models have been employed in TM4SF1 research:

  • Cancer Cell Lines: Multiple human cancer cell lines show differential TM4SF1 expression, including:

    • Breast cancer: MDA-MB-231, MDA-MB-453

    • Lung cancer: H460, H2030, H1975

    • Melanoma: A375, A2058

  • Tumor Sphere Formation Assays: These assess cancer stem cell properties, with TM4SF1-high cells demonstrating enhanced sphere formation capabilities upon serial passage .

  • Engineered Human Vessels in Nude Mice: A model using human endothelial colony-forming cells (ECFC) mixed with mesenchymal stem cells (MSC) in Matrigel plugs implanted subcutaneously in nude mice allows study of TM4SF1 in human vessel formation .

  • Patient-Derived Models: Analysis of patient samples, particularly circulating cells in PAH and other conditions, provides translational relevance to TM4SF1 studies .

What are the methodological considerations when targeting TM4SF1 with antibodies?

When developing or using antibodies against TM4SF1, researchers should consider:

  • Epitope Selection: The larger extracellular loop (EL2) has proven to be an effective target for antibody binding. For example, studies have successfully generated antibodies against EL2, such as the high-affinity (Kd ~1 nM) 8G4 (IgG1 subtype) .

  • Species Cross-Reactivity: Many antibodies against human TM4SF1 do not cross-react with mouse TM4SF1, necessitating humanized models for in vivo efficacy studies .

  • Validation Methods: Effective validation includes:

    • Immunocytochemistry comparing TM4SF1-overexpressing cells versus low-expressing controls

    • Flow cytometry for quantitative binding assessment

    • Functional assays to confirm antibody effects on TM4SF1-dependent processes

How does TM4SF1 contribute to cancer stem cell maintenance?

TM4SF1 plays a critical role in maintaining cancer stem cell (CSC) properties through multiple mechanisms:

  • Activation of JAK2-STAT3 Signaling: TM4SF1 couples with discoidin domain receptor tyrosine kinase 1 (DDR1) under collagen I stimulation, activating JAK2-STAT3 signaling. This noncanonical DDR1 signaling pathway sustains CSC traits by inducing expression of pluripotency factors SOX2 and NANOG .

  • Enrichment of CSC Population: TM4SF1-high cancer cells are enriched for established CSC markers. For instance, there are more CD44high/CD24low cells (a known CSC marker signature) among TM4SF1-high MDA-MB-231 human breast cancer cells compared to TM4SF1-low populations .

  • Enhanced Self-Renewal Capacity: TM4SF1-high cancer cells demonstrate superior tumor sphere formation upon serial passage compared to TM4SF1-low cells across multiple cancer types, indicating enhanced self-renewal capability .

  • Upregulation of Pluripotency Factors: TM4SF1-high cells show elevated expression of pluripotency factors across various human cancer cell lines, reinforcing stem-like phenotypes .

What is the relationship between TM4SF1 expression and cancer metastasis?

TM4SF1 promotes cancer metastasis through several coordinated mechanisms:

  • Epithelial-Mesenchymal Transition (EMT) Induction: TM4SF1 promotes the migration and invasion of cancer cells by inducing EMT, enhancing cellular plasticity and invasive capabilities .

  • Multi-Organ Metastatic Potential: The TM4SF1-DDR1-JAK2-STAT3 signaling axis drives metastasis to multiple organs. In breast cancer, this pathway promotes metastasis to lung, bone, brain, and other target organs .

  • Molecular Coordination: TM4SF1 couples with collagen receptor DDR1 and then recruits Syntenin-2 and PKC, which activates the downstream JAK2-STAT3 pathway. This coordinated signaling cascade promotes expression of stem cell transcription factors (Sox2, Oct4, Nanog) that facilitate metastatic spread .

  • Angiogenesis Support: TM4SF1 promotes tumor angiogenesis, creating conduits for metastatic spread .

How is TM4SF1 involved in tumor vascularization and angiogenesis?

TM4SF1 plays a dual role in tumor vascularization:

  • Endothelial Cell Expression: TM4SF1 is highly expressed on vascular endothelial cells lining tumor blood vessels, making it a potential target for disrupting tumor vasculature .

  • Angiogenic Regulation: It promotes tumor angiogenesis, contributing to the formation of new blood vessels that support tumor growth and metastasis .

  • Endothelial Progenitor Function: TM4SF1 marks a subpopulation of endothelial stem/progenitor cells. In pulmonary arterial hypertension (PAH), TM4SF1 is specifically expressed in hematopoietic stem cell/multipotent progenitor 1 cells (HSC/MPP1), suggesting its role in vascular progenitor function .

  • Vascular Remodeling: The mechanisms by which TM4SF1 promotes cancer cell migration and invasion (EMT induction, self-renewal) are also relevant to pathological vascular remodeling, as seen in conditions like PAH .

What are the key signaling pathways regulated by TM4SF1 in cancer cells?

TM4SF1 regulates several critical signaling pathways in cancer cells:

  • DDR1-JAK2-STAT3 Pathway: TM4SF1 couples with collagen receptor DDR1 under collagen I stimulation, recruiting Syntenin-2 and PKC to activate JAK2-STAT3 signaling. This pathway promotes expression of pluripotency factors Sox2, Oct4, and Nanog .

  • PDZ-Domain Interactions: The C-terminal cytoplasmic portion of TM4SF1 contains an unconventional PDZ-domain-binding motif (X-Tyr-X-Cys) that interacts with syntenin-2, further activating syntenin-1 to support cancer cell proliferation and migration .

  • Lipid Raft Organization: TM4SF1 impacts the organization of lipid rafts, facilitating cell signaling pathways essential for cell growth and survival .

  • EMT Regulation: TM4SF1 activates pathways that induce epithelial-mesenchymal transformation, enhancing invasive capabilities .

How does the interaction between TM4SF1 and DDR1 modulate downstream signaling?

The TM4SF1-DDR1 interaction represents a critical mechanism in cancer progression:

  • Collagen-Dependent Activation: Under collagen I stimulation, TM4SF1 couples with DDR1 (a receptor tyrosine kinase), initiating a noncanonical signaling cascade .

  • Recruitment of Signaling Mediators: Following coupling with DDR1, TM4SF1 recruits Syntenin-2 and PKC, essential mediators for downstream signal transduction .

  • JAK2-STAT3 Activation: This complex subsequently activates JAK2-STAT3 signaling, a pathway critically involved in cancer stemness, proliferation, and metastasis .

  • Transcriptional Regulation: The activated JAK2-STAT3 pathway ultimately promotes expression of downstream transcription factors Sox2, Oct4, and Nanog, which maintain stemness properties and drive metastatic potential .

  • Therapeutic Target: Disrupting the interaction between DDR1 and TM4SF1 with antibody drugs represents a potential therapeutic strategy to inhibit this pro-metastatic signaling pathway .

What molecular mechanisms link TM4SF1 to cellular senescence in cancer models?

Recent research has uncovered the relationship between TM4SF1 and cellular senescence in cancer:

  • Senescence Induction: Targeting TM4SF1 promotes tumor senescence in hepatocellular carcinoma (HCC) models, suggesting TM4SF1 normally functions to prevent cellular senescence .

  • Immune System Connection: In HCC, targeting TM4SF1 enhances CD8+ T cell cytotoxic function, indicating a link between TM4SF1, senescence, and anti-tumor immunity .

  • Senescence Assessment Methods: Cellular senescence in response to TM4SF1 targeting can be assessed through SA-β-gal activity assays and Western blot analysis of senescence markers .

What approaches have been developed for targeting TM4SF1 in cancer therapy?

Several therapeutic approaches targeting TM4SF1 have been developed or are under investigation:

  • Monoclonal Antibodies: Antibodies targeting the functional extracellular domain of TM4SF1 have shown inhibitory effects on cancer stem cells. Researchers have generated mouse monoclonal antibodies against human TM4SF1, with 13 antibodies reacting with extracellular loop-2 (EL2) .

  • CAR-T Cell Therapy: A phase 1/2 clinical trial (NCT04151186) is evaluating chimeric antigen receptor T-cells (CAR-T) targeting TM4SF1 in patients with TM4SF1-positive pancreatic, colorectal, gastric, and lung cancer .

  • Signaling Pathway Inhibition: JAK2 kinase inhibitors represent a potential therapeutic approach, targeting the downstream signaling activated by TM4SF1 .

  • Disruption of Protein Interactions: Therapeutic strategies aimed at disrupting the interaction between DDR1 and TM4SF1 using antibody drugs could inhibit the pro-metastatic signaling pathway .

What are the challenges in developing antibodies against TM4SF1?

Development of effective antibodies against TM4SF1 faces several challenges:

  • Species Cross-Reactivity: Many antibodies against human TM4SF1 do not cross-react with mouse TM4SF1, necessitating humanized models for in vivo efficacy studies. Researchers have turned to models where human blood vessels can be generated in mice to overcome this limitation .

  • Epitope Selection: The structure of TM4SF1 includes smaller extracellular domains compared to other therapeutic targets, limiting potential binding sites. The larger extracellular loop (EL2) has been the primary target for antibody development .

  • Functional Activity: Developing antibodies that not only bind to TM4SF1 but also functionally inhibit its activity requires sophisticated screening approaches beyond simple binding assays .

  • Tumor Penetration: As with many antibody therapeutics, ensuring sufficient penetration into solid tumors represents an ongoing challenge for TM4SF1-targeted antibodies.

How can TM4SF1's dual expression in cancer cells and tumor vasculature be leveraged for therapy?

TM4SF1's expression pattern offers unique therapeutic opportunities:

  • Dual-Targeting Potential: TM4SF1 is highly expressed in both tumor cells and on vascular endothelial cells lining tumor blood vessels, potentially allowing simultaneous targeting of both cancer cells and tumor vasculature with a single agent .

  • Tumor Selectivity: Immunohistochemistry staining of 16 cancer types showed TM4SF1 is highly expressed on cancer cell membranes but undetectably expressed on normal cells, suggesting a favorable therapeutic window .

  • Anti-Angiogenic Strategy: Targeting TM4SF1 on tumor endothelium could disrupt angiogenesis and vascular supply to tumors, complementing direct anti-cancer effects .

  • CSC Elimination: TM4SF1-targeted therapies may specifically eliminate cancer stem cells, addressing the root cause of tumor recurrence and therapy resistance .

What are the contradictions or inconsistencies in current TM4SF1 research that need resolution?

Several areas require further investigation to resolve inconsistencies:

  • Tissue-Specific Functions: While TM4SF1 promotes progression in many cancers, its functions may vary across tissue contexts. Systematic comparison across cancer types is needed to determine tissue-specific versus universal mechanisms.

  • Normal Physiological Role: Despite significant research on TM4SF1 in pathological conditions, its precise functions in normal tissue homeostasis remain undercharacterized, creating a gap in understanding its full biological significance.

  • Interaction Networks: While the TM4SF1-DDR1 interaction has been characterized, comprehensive protein-protein interaction networks for TM4SF1 across different cellular contexts are still incomplete.

  • Regulatory Mechanisms: Current literature provides limited insight into how TM4SF1 expression is regulated at transcriptional, post-transcriptional, and epigenetic levels, representing an important research gap.

How can researchers develop more physiologically relevant models to study TM4SF1 function?

Advanced model systems that better recapitulate the complexity of TM4SF1 biology include:

  • Patient-Derived Organoids (PDOs): Three-dimensional culture systems derived directly from patient tissues preserve cellular heterogeneity and better represent in vivo TM4SF1 function compared to traditional cell lines.

  • Humanized Mouse Models: Given the lack of cross-reactivity between human and mouse TM4SF1 antibodies, development of humanized mouse models with human TM4SF1 expression patterns would facilitate in vivo therapeutic studies.

  • Engineered Human Vasculature Models: Building upon the Matrigel model described in the literature , more complex engineered human vessel systems incorporating TM4SF1-expressing endothelial cells could better model tumor-vasculature interactions.

  • Single-Cell Analysis Approaches: Application of single-cell RNA sequencing and proteomics to TM4SF1-expressing cells could reveal heterogeneity and identify distinct functional subpopulations not apparent in bulk analyses.

What are promising emerging applications of TM4SF1 research beyond cancer?

TM4SF1 research has implications beyond cancer:

  • Pulmonary Arterial Hypertension (PAH): TM4SF1 is upregulated in PAH patient blood samples, with higher expression correlating with worse WHO functional class. This suggests TM4SF1 as a potential biomarker or therapeutic target in PAH .

  • Vascular Biology: As a marker for endothelial stem/progenitor cells, TM4SF1 may have applications in regenerative medicine approaches for vascular diseases .

  • Inflammatory Disorders: Given the role of TM4SF1 in cell motility and signaling, investigation into its function in inflammatory and immune cells could reveal new therapeutic applications.

  • Diagnostic Applications: The specific expression pattern of TM4SF1 in cancer versus normal tissues suggests potential applications as a diagnostic biomarker across multiple cancer types .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.