Recombinant Human Transmembrane 4 L6 family member 4 (TM4SF4)

Shipped with Ice Packs
In Stock

Description

Production Systems and Variants

Recombinant TM4SF4 is produced in multiple expression systems, each offering unique advantages for structural and functional studies:

Expression SystemCodeFeatures
YeastCSB-YP023619HUHigh purity; suitable for basic research
E. coliCSB-EP023619HU-BAvi-tag biotinylated for affinity purification
BaculovirusCSB-BP023619HUEukaryotic post-translational modifications
Mammalian CellsCSB-MP023619HUNative-like glycosylation; ideal for functional assays

Full-length His-tagged variants (e.g., RFL5199HF) expressed in E. coli or HEK293 cells are widely used for antibody development and interaction studies .

Functional Roles in Cellular Processes

TM4SF4 regulates key oncogenic pathways:

  • Cell Proliferation and Motility: Mediates density-dependent proliferation in intestinal epithelial cells and enhances cancer cell migration and invasion .

  • Mitochondrial Regulation: In hepatocellular carcinoma (HCC), TM4SF4 expression correlates with mitochondrial components and oxidative phosphorylation pathways, suggesting roles in metabolic reprogramming .

  • Chemoresistance: Overexpression in lung adenocarcinoma confers radiation resistance via IGF1/IGF1R signaling .

In Vitro and In Vivo Studies

  • Knockdown Effects: siRNA-mediated TM4SF4 suppression reduces lung cancer cell growth by 50% and decreases invasiveness .

  • Overexpression: Enhances tumorigenicity in xenograft models, with anti-TM4SF4 antibodies inhibiting tumor growth by 90% .

  • Clinical Correlations: High TM4SF4 expression in HCC correlates with poor prognosis and hypomethylation, validated across TCGA and GTEx datasets .

Comparative Analysis with Other Targets

TM4SF4 demonstrates superior specificity for HCC therapy compared to common targets:

TargetNormal Tissue ExpressionHCC ExpressionTherapeutic Potential
TM4SF4Low (GI tract, pancreas)HighHigh (restricted off-target)
CD133UbiquitousModerateModerate
GPC3ModerateHighHigh

Therapeutic and Diagnostic Applications

  • Antibody Development: Anti-TM4SF4 antibodies show efficacy in preclinical models, reducing xenograft tumor volumes by >80% .

  • Biomarker Potential: Overexpression in HCC and colorectal cancer tissues positions TM4SF4 as a diagnostic marker .

  • Drug Resistance Studies: TM4SF4-linked pathways (e.g., IGF1R) are targets for overcoming chemoresistance .

Future Directions

Current research focuses on:

  • Mechanistic Pathways: Elucidating TM4SF4’s role in mitochondrial dysfunction and metastasis .

  • Clinical Trials: Evaluating anti-TM4SF4 therapies in HCC and lung adenocarcinoma .

  • Multi-Omics Integration: Leveraging scRNA-seq and proteomics to refine targeting strategies .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, if you have a specific format requirement, please indicate it in your order remarks and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timelines, please consult your local distributor.
Note: All proteins are shipped with standard blue ice packs unless otherwise requested. If you require dry ice shipment, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, it is recommended to briefly centrifuge the vial to ensure the contents settle at the bottom. Reconstitute the protein with deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life of the product is influenced by several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life for the liquid form is 6 months at -20°C/-80°C. The lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Synonyms
TM4SF4; ILTMP; Transmembrane 4 L6 family member 4; Intestine and liver tetraspan membrane protein; IL-TMP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-202
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
TM4SF4
Target Protein Sequence
MCTGGCARCLGGTLIPLAFFGFLANILLFFPGGKVIDDNDHLSQEIWFFGGILGSGVLMI FPALVFLGLKNNDCCGCCGNEGCGKRFAMFTSTIFAVVGFLGAGYSFIISAISINKGPKC LMANSTWGYPFHDGDYLNDEALWNKCREPLNVVPWNLTLFSILLVVGGIQMVLCAIQVVN GLLGTLCGDCQCCGCCGGDGPV
Uniprot No.

Target Background

Function
TM4SF4 plays a crucial role in regulating the adhesive and proliferative properties of intestinal epithelial cells. It can mediate density-dependent cell proliferation.
Gene References Into Functions
  1. Substitution of the transmembrane 4 L six family protein TM4SF1 or TM4SF4 C-terminus with that of TM4SF5 led to increased spheroid growth, transwell migration, and invasive dissemination from spheroids in 3D collagen gels. PMID: 28129652
  2. TM4SF4 expression was positively correlated with elevated IGF1 expression, subsequently activating IGF1R in lung adenocarcinoma. PMID: 25344917
  3. TM4SF4 interacts with hTHTR-2 and influences the physiological function of the thiamine transporter in human intestinal epithelial cells. PMID: 24282057
  4. TM4SF4, a membrane protein, potentially plays a role in attenuating liver cancer cell growth. PMID: 23296076
  5. Research suggests that overexpression of S100B, TM4SF3, and OLFM4 may impact metastatic behavior of tumor cells in Taiwanese colorectal cancer patients. PMID: 22011044
  6. Expression of transmembrane 4 superfamily member 4 (TM4SF4) and matrix metalloproteinase 26 (MMP26) was found to be significantly decreased during the implantation window in patients with polycystic ovary syndrome. PMID: 18765015

Show More

Hide All

Database Links

HGNC: 11856

OMIM: 606567

KEGG: hsa:7104

STRING: 9606.ENSP00000305852

UniGene: Hs.133527

Protein Families
L6 tetraspanin family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Jejunum and liver.

Q&A

What is the expression profile of TM4SF4 in normal human tissues?

TM4SF4 exhibits a distinctive tissue distribution pattern with significantly lower expression in most normal tissues compared to other common therapeutic targets. Based on data from multiple transcriptomic databases (FANTOM5, GTEx, and HPA), TM4SF4 is primarily expressed in the gastrointestinal tract and pancreas . Immunohistochemistry data from the Human Protein Atlas demonstrates that in normal liver tissues, TM4SF4 protein is specifically localized only in the bile duct canaliculi, a region that is inaccessible to immune cells . This restricted expression profile makes TM4SF4 particularly interesting for targeted therapies with potentially reduced off-target effects.

Table 1: Comparative Expression of TM4SF4 versus Other Common Cell Surface Targets in Normal Human Tissues

DatabaseTM4SF4 vs Other TargetsPrimary TM4SF4 Expression Sites
FANTOM5 (n=45 tissues)Significantly lower (p<0.05)Gastrointestinal tract, Pancreas
GTEx (n=54)Significantly lower (p<0.01)Gastrointestinal tract, Pancreas
HPA (n=253)Significantly lower (p<1×10^-11)Gastrointestinal tract, Pancreas

How does TM4SF4 expression in cancer tissues differ from normal tissues?

TM4SF4 shows marked upregulation in several cancer types compared to corresponding normal tissues. In hepatocellular carcinoma (HCC), TM4SF4 protein is significantly overexpressed compared to paired non-cancerous liver tissues . This upregulation extends to the subcellular localization pattern, where TM4SF4 is present on all sides of the plasma membrane domains in HCC cells, unlike its restricted localization in normal liver tissues .

Similarly, differential expression analysis indicates that TM4SF4 is significantly upregulated in papillary thyroid cancer (PTC) compared to normal thyroid tissue, as corroborated by both local cohort studies and Human Protein Atlas data . The distinctive expression profile of higher levels in cancer tissues with restricted expression in normal tissues positions TM4SF4 as a promising candidate for cancer-targeted therapies.

Which signaling pathways involve TM4SF4 in cancer progression?

Research has identified several key signaling pathways through which TM4SF4 promotes cancer progression:

  • AKT Pathway: In papillary thyroid cancer, TM4SF4 appears to promote progression via AKT signaling. Studies have shown that the AKT activator SC79 can reverse the suppression of malignant behaviors caused by TM4SF4 knockdown, suggesting that TM4SF4 may promote PTC progression through this pathway .

  • IGF1R Activation: In lung carcinoma cells, TM4SF4 overexpression results in resistance to radiotherapy via IGF1-induced IGF1R activation . This mechanism contributes to radioresistance and enhanced tumor cell survival.

  • Mitochondrial Function: Gene Ontology enrichment analysis in HCC cells reveals that TM4SF4 expression is associated with mitochondrial components and energy production, suggesting a role in mitochondrial-mediated oncogenic effects . Genes highly correlated with TM4SF4 expression in HCC include those involved in cellular detoxification, lipid processes, and nucleotide synthesis or metabolism.

How does TM4SF4 modulation affect cancer cell phenotypes?

Experimental modulation of TM4SF4 expression produces significant changes in cancer cell behaviors:

Table 2: Effects of TM4SF4 Modulation on Cancer Cell Phenotypes

Cancer TypeInterventionObserved EffectsReference
Lung carcinoma (A549)TM4SF4 knockdownReduced cell growth (50% of control), decreased radiation resistance, slower wound closure, reduced migration and invasion
Lung carcinoma (A549)TM4SF4 overexpressionEnhanced cell growth, increased radiation resistance, faster wound closure, increased migration and invasion
Papillary thyroid cancerTM4SF4 knockdownSuppressed proliferation and metastasis, induced apoptosis
Hepatocellular carcinomaTM4SF4 knockdownImpaired growth potential in vitro, repressed tumor growth in xenograft models, attenuated proliferation and migration
Hepatocellular carcinomaTM4SF4 overexpressionInduced cell growth and colony formation

These findings collectively demonstrate that TM4SF4 functions as an oncoprotein across multiple cancer types, promoting proliferation, migration, invasion, and therapy resistance.

What distinguishes TM4SF4 from other members of the TM4SF family?

Despite structural similarities, TM4SF4 exhibits distinct functional characteristics from other TM4SF family members:

How does TM4SF4 contribute to hepatocellular carcinoma development?

TM4SF4 has emerged as a key player in hepatocellular carcinoma:

  • Expression Analysis: TM4SF4 is the top-ranked surface target with the highest expression in HCCs compared to other potential targets across multiple datasets (TCGA, CNHPP, GSE14520, and CHCC) .

  • Cellular Mechanisms: TM4SF4 functions as an oncoprotein in HCCs, with knockdown studies demonstrating its role in promoting growth, proliferation, and migration .

  • Gene Associations: In scRNA-seq data, TM4SF4 expression in HCC cells is associated with mitochondrial components and energy production Gene Ontologies, suggesting its involvement in metabolic reprogramming .

  • In Vivo Significance: TM4SF4 knockdown represses tumor growth in a mouse xenograft model of human HCC, confirming its functional relevance in vivo .

What is TM4SF4's clinical significance in papillary thyroid cancer?

TM4SF4 has significant clinical correlations in papillary thyroid cancer:

Table 3: Clinical Correlations of TM4SF4 Expression in PTC Patients

Clinical FeatureAssociation with High TM4SF4 ExpressionStatistical Significance
Classical PTC typePositive correlationp < 0.001
Lymph node metastasis (LNM)Increased riskp < 0.001 (TCGA), p = 0.029 (local cohort)
Prediction of LNM (univariate)OR = 2.186, 95% CI = 1.500–3.185p < 0.001
Prediction of LNM (multivariate)OR = 1.786, 95% CI = 1.181–2.700p = 0.006

These findings from both TCGA and local patient cohorts demonstrate that TM4SF4 expression serves as an independent prediction factor for lymph node metastasis in PTC patients , suggesting potential utility as a prognostic biomarker.

What other cancer types show significant TM4SF4 involvement?

Beyond HCC and PTC, TM4SF4 has been implicated in several other cancer types:

  • Lung Cancer: TM4SF4 overexpression enhances cell growth, migration, invasion, and radioresistance in lung carcinoma cells . It was identified as one of the top five genes significantly expressed in alectinib-resistant lung cancer patients .

  • Colorectal Cancer: TM4SF4 has been implicated in the epithelial-mesenchymal transition (EMT) process and progression of colorectal cancer .

  • Pancreatic Development: While not directly cancer-related, TM4SF4 is regulated by Nkx2.2 in pancreatic development and is expressed in endocrine progenitor cells , which may have implications for pancreatic cancer research.

What are optimal techniques for studying TM4SF4 expression in research samples?

Several complementary approaches provide comprehensive insights into TM4SF4 expression:

  • Transcriptomic Analysis:

    • Bulk RNA-seq and microarray technologies for tissue-level expression

    • Single-cell RNA sequencing (scRNA-seq) for cell-type specific expression profiles

    • RT-qPCR for validation of expression changes

  • Protein Detection:

    • Western blotting for semi-quantitative protein level assessment

    • Immunohistochemistry (IHC) for spatial localization within tissues

    • Immunofluorescence for subcellular localization

    • Mass spectrometry for unbiased proteomics analysis

  • Advanced Visualization:

    • For scRNA-seq data analysis, dimensionality reduction techniques like UMAP (Uniform Manifold Approximation and Projection) enable visualization of TM4SF4 expression across different cell populations

    • Expression gradients can be visualized using color spectra (e.g., light pink to dark red), with non-expressing cells depicted in gray

What methods are effective for modulating TM4SF4 expression in experimental models?

Several approaches have been successfully employed:

  • Knockdown Strategies:

    • siRNA-mediated suppression has effectively reduced TM4SF4 expression in various cancer cell lines

    • shRNA for stable knockdown in long-term experiments

  • Overexpression Systems:

    • Transfection with TM4SF4-expressing vectors for gain-of-function studies

    • Stable cell lines with inducible expression systems for controlled studies

  • Functional Inhibition:

    • Anti-TM4SF4 antibodies can be used to neutralize protein function (e.g., at concentrations of 1-3 μg/ml as documented in colony-forming assays)

  • Domain Analysis:

    • C-terminal deletion or chimeric mutants to study domain-specific functions

    • Site-directed mutagenesis for analysis of specific residues

  • In Vivo Models:

    • Xenograft models with TM4SF4-modulated cell lines

    • Genetic mouse models for developmental studies

How can protein interactions with TM4SF4 be studied effectively?

Understanding TM4SF4's interactome is crucial for elucidating its function:

  • Yeast Two-Hybrid:

    • The split-ubiquitin two-hybrid approach has been used to screen human intestinal cDNA libraries for TM4SF4-interacting proteins

  • Pull-Down Assays:

    • GST-pull-down approaches can confirm protein-protein interactions

  • Co-Immunoprecipitation:

    • For verification of endogenous protein interactions in relevant cell types

  • Cellular Co-localization:

    • Fluorescently tagged constructs (like mCherry-TM4SF4) can be used to visualize co-localization with potential partner proteins

    • Advanced microscopy techniques such as FRET or BRET for direct interaction assessment

  • Functional Validation:

    • Uptake assays or other functional tests to determine the physiological consequences of protein interactions

    • For example, 3H-thiamine uptake assays were used to examine the effect of TM4SF4 interaction with hTHTR-2

What makes TM4SF4 a promising immunotherapy target for hepatocellular carcinoma?

TM4SF4 possesses several characteristics that make it an attractive target for immunotherapy in HCC:

  • Favorable Expression Profile: TM4SF4 demonstrates significantly lower expression in normal human tissues but high expression in HCC cases compared with seven other common HCC therapeutic targets (CD24, CD133, CD147, EPCAM, GPC3, MET, and MUC1) .

  • Cell Surface Accessibility: As a transmembrane protein located on the cell surface, TM4SF4 is accessible to antibody-based therapies and cell-based approaches like CAR T cells .

  • Restricted Normal Expression: In normal liver, TM4SF4 is only expressed in the bile duct canaliculi, a region that is inaccessible to immune cells, potentially reducing on-target, off-tumor toxicity .

  • Functional Significance: Its role in promoting cancer cell proliferation, migration, and invasion makes it functionally relevant as a therapeutic target .

The multiomics analysis identifying TM4SF4 as a top target provides strong evidence to support the development of anti-TM4SF4 immunotherapies such as CAR T cells against HCCs .

What methodological approaches are most effective for validating TM4SF4 as a therapeutic target?

A comprehensive validation strategy for TM4SF4 as a therapeutic target should include:

  • Expression Validation:

    • Multi-cohort analysis across diverse datasets (e.g., TCGA, CNHPP, GSE14520, CHCC)

    • Comparison with normal tissues to assess potential off-target effects

    • Single-cell analysis to confirm cancer-specific expression

  • Functional Validation:

    • In vitro knockdown/overexpression studies to confirm oncogenic role

    • Pathway analysis to understand mechanism of action

    • Rescue experiments (e.g., with pathway activators like SC79 for AKT)

  • Preclinical Models:

    • Xenograft models to assess in vivo relevance

    • Patient-derived organoids or xenografts for translational validation

    • Imaging studies to confirm target accessibility

  • Therapeutic Development:

    • Antibody development and characterization

    • CAR T cell or other cellular therapy design

    • Assessment of on-target, off-tumor effects

  • Biomarker Analysis:

    • Correlation with clinical outcomes to identify patient subgroups most likely to benefit

    • Development of companion diagnostics

What are unresolved questions about TM4SF4 that warrant further investigation?

Despite significant progress, several important questions about TM4SF4 remain unanswered:

  • Structural Biology:

    • Detailed structural characterization of TM4SF4, particularly its extracellular domains that would be targeted by antibodies

    • Crystal structure of TM4SF4 in complex with binding partners

  • Signaling Mechanisms:

    • Comprehensive mapping of TM4SF4 interactome in different cancer contexts

    • Detailed characterization of how TM4SF4 activates the AKT pathway and other signaling cascades

    • Role in mitochondrial function and metabolic reprogramming

  • Therapeutic Resistance:

    • Potential mechanisms of resistance to TM4SF4-targeted therapies

    • Rational combinations to overcome resistance

  • Developmental Biology:

    • The normal physiological roles of TM4SF4 in tissue development and homeostasis

    • Consequences of long-term TM4SF4 inhibition

  • Translational Research:

    • Optimal antibody or cellular therapy design

    • Patient selection strategies

    • Toxicity prediction and management

Table 4: Gene Ontology Enrichment Analysis of TM4SF4-Correlated Genes in HCC

GO CategoryEnriched Terms in HCCq-valueTop Correlated Genes
Mitochondrial ComponentsMitochondrial components and energy production< 0.01CLU, SCP2, SDHC
MetabolismCellular detoxification< 0.01ALB, AGT
Lipid ProcessesLipid metabolism< 0.01SCP2
Nucleotide ProcessesNucleotide synthesis/metabolism< 0.01Various

This GO enrichment analysis was conducted on genes highly correlated (Pearson r > 0.6) with TM4SF4 expression in scRNA-seq data from HCC cells (n=15,787 cells from 10 patients) .

What are the critical controls needed for TM4SF4 expression studies?

Rigorous TM4SF4 research requires several key controls:

  • Antibody Validation:

    • Positive and negative tissue controls based on known expression patterns

    • Validation by orthogonal methods (e.g., antibodies consistent with transcript expression data)

    • Western blot confirmation of specificity

  • Expression Analysis:

    • Paired normal/tumor tissue comparisons from the same patient

    • Multiple independent cohorts (e.g., TCGA, local validation cohorts)

    • Multiple analysis methods (e.g., RT-qPCR, IHC, RNA-seq)

  • Functional Studies:

    • Multiple siRNA sequences to control for off-target effects

    • Rescue experiments with siRNA-resistant constructs

    • Appropriate vector controls for overexpression studies

    • Time-course analyses to distinguish direct from indirect effects

  • Clinical Correlations:

    • Multivariate analyses to control for confounding factors

    • Independent validation cohorts

    • Clear definition of clinical endpoints

How should researchers design experiments to investigate TM4SF4's impact on cancer cell resistance?

Based on existing research showing TM4SF4's role in therapy resistance , a comprehensive experimental design would include:

  • Cell Line Selection:

    • Cancer cell lines with varying baseline TM4SF4 expression

    • Paired sensitive/resistant cell line models

    • Patient-derived cell lines to capture clinical heterogeneity

  • Resistance Modeling:

    • Radiation resistance models (as in A549 cells, where 20 Gy gamma irradiation has been used)

    • Drug resistance models (e.g., targeted therapies, chemotherapy)

    • Acute vs. chronic resistance development

  • Mechanistic Studies:

    • Pathway analysis focusing on AKT and IGF1R signaling

    • Combination with pathway inhibitors to determine rescue effects

    • Global transcriptomic and proteomic changes

  • Functional Assays:

    • Colony forming assays following treatment (2×10³ cells per plate, 10-day incubation)

    • Apoptosis and cell cycle analysis

    • Migration and invasion assays to assess phenotypic changes

    • In vivo resistance studies in xenograft models

  • Clinical Correlation:

    • TM4SF4 expression in treatment-naïve vs. post-treatment samples

    • Correlation with progression-free survival after specific therapies

What are the most robust methods for analyzing TM4SF4 expression in heterogeneous tumor samples?

Tumor heterogeneity presents significant challenges for accurate TM4SF4 assessment:

  • Single-Cell Technologies:

    • scRNA-seq to identify cell type-specific expression patterns

    • UMAP or t-SNE visualization to identify distinct cell populations

    • Correlation analysis with cell type-specific markers

  • Spatial Transcriptomics/Proteomics:

    • Techniques like Visium or CODEX that preserve spatial information

    • Multiplex immunofluorescence to co-localize TM4SF4 with cell type markers

    • Digital spatial profiling for quantitative spatial analysis

  • Deconvolution Approaches:

    • Computational methods to estimate cell type proportions in bulk data

    • Integration of scRNA-seq with bulk RNA-seq for improved resolution

    • Gene signature-based approaches for specific cell populations

  • Validation Strategies:

    • Multi-region sampling to capture spatial heterogeneity

    • Longitudinal sampling to capture temporal heterogeneity

    • Integration of multiple data types (e.g., genomics, transcriptomics, proteomics)

  • Data Analysis:

    • Pearson correlation analysis of TM4SF4 with other genes (r ≥ 0.6 cutoff has been used)

    • Gene Set Enrichment Analysis (GSEA) to identify associated pathways

    • ssGSEA algorithm to assess immune cell infiltration levels in relation to TM4SF4 expression

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.