Recombinant Human Transmembrane 7 superfamily member 4 (TM7SF4)

Shipped with Ice Packs
In Stock

Description

Osteoclastogenesis and Bone Homeostasis

TM7SF4 is critical for osteoclast multinucleation and bone resorption. Key findings include:

  • Mechanism: Cooperates with OC-STAMP to mediate cell-cell fusion during osteoclast formation .

  • Regulation: Expression is upregulated by RANKL (receptor activator of nuclear factor kappa-B ligand) and suppressed by miR-7a-1 .

  • Disease Relevance: Linked to Paget’s disease of bone and osteoporosis due to dysregulated osteoclast activity .

Immune Regulation

  • Dendritic Cell Function: Modulates antigen presentation and phagocytic activity, influencing immune tolerance .

  • Myeloid Differentiation: Inhibits granulocyte development while promoting myeloid lineage commitment .

Cancer Progression

TM7SF4 drives tumor growth and metastasis in multiple cancers:

Cancer TypeKey FindingsSource
Breast CancerDownregulation reduces colony formation (30 ± 1 vs. 11 ± 3 colonies) and increases apoptosis (5.82% vs. 9.84%) .
Lung Cancer (A549)Silencing TM7SF4 inhibits proliferation and metastasis via PI3K/AKT/mTOR pathway suppression .
AMLHigh expression correlates with adverse outcomes, suggesting a role in leukemia progression .

Research Applications

Recombinant TM7SF4 is utilized to study:

  • Cellular Fusion Mechanisms: Osteoclast and foreign body giant cell formation .

  • Cancer Therapeutics: Targeting TM7SF4 in breast and lung cancer models reduces tumor growth and metastasis .

  • Autoimmune Diseases: Modulating DC-STAMP activity to restore immune tolerance .

Mechanistic Gaps

  • The exact signaling pathways downstream of TM7SF4 in immune regulation remain unclear .

  • Limited data on isoform-specific functions due to alternative splicing .

Therapeutic Potential

  • Small-Molecule Inhibitors: Preclinical studies targeting TM7SF4 in osteoclast-related disorders show promise .

  • Biomarker Development: High TM7SF4 expression in AML and breast cancer highlights its diagnostic potential .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributors for specific delivery time estimates.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
DCSTAMP; TM7SF4; Dendritic cell-specific transmembrane protein; DC-STAMP; hDC-STAMP; Dendrocyte-expressed seven transmembrane protein; IL-four-induced protein; FIND; Transmembrane 7 superfamily member 4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-470
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
DCSTAMP
Target Protein Sequence
MGIWTSGTDIFLSLWEIYVSPRSPGWMDFIQHLGVCCLVALISVGLLSVAACWFLPSIIA AAASWIITCVLLCCSKHARCFILLVFLSCGLREGRNALIAAGTGIVILGHVENIFHNFKG LLDGMTCNLRAKSFSIHFPLLKKYIEAIQWIYGLATPLSVFDDLVSWNQTLAVSLFSPSH VLEAQLNDSKGEVLSVLYQMATTTEVLSSLGQKLLAFAGLSLVLLGTGLFMKRFLGPCGW KYENIYITRQFVQFDERERHQQRPCVLPLNKEERRKYVIIPTFWPTPKERKNLGLFFLPI LIHLCIWVLFAAVDYLLYRLIFSVSKQFQSLPGFEVHLKLHGEKQGTQDIIHDSSFNISV FEPNCIPKPKFLLSETWVPLSVILLILVMLGLLSSILMQLKILVSASFYPSVERKRIQYL HAKLLKKRSKQPLGEVKRRLSLYLTKIHFWLPVLKMIRKKQMDMASADKS
Uniprot No.

Target Background

Function
Transmembrane 7 superfamily member 4 (TM7SF4) is a probable cell surface receptor that plays a crucial role in various cellular processes, including fusion, differentiation, bone and immune homeostasis. It is involved in TNFSF11-mediated osteoclastogenesis, cooperating with OCSTAMP to regulate cell-cell fusion in osteoclasts and foreign body giant cells (FBGCs). TM7SF4 participates in osteoclast bone resorption, inducing the expression of tartrate-resistant acid phosphatase in osteoclast precursors. It also plays a significant role in hematopoietic stem cell differentiation within bone marrow towards the myeloid lineage, inhibiting the development of neutrophilic granulocytes. Additionally, TM7SF4 regulates dendritic cell (DC) antigen presentation activity by controlling phagocytic activity, contributing to the maintenance of immune self-tolerance and prevention of autoimmune reactions.
Gene References Into Functions
  1. TM7SF4 may be involved in the progression of lung cancer. PMID: 28849122
  2. Research suggests that rare genetic variants within the TM7SF4 gene, identified in a French-Canadian cohort of patients with Paget's disease of bone, encoding the DC-STAMP protein, increase the number of nuclei per multinucleated cells and influence DC-STAMP expression during osteoclastogenesis in Paget's disease of bone. PMID: 29145829
  3. TM7SF4 plays a critical role in regulating cell cycle progression in breast cancer. PMID: 26636523
  4. The expression profile (EP) in total knee arthroplasty (TKA) differed from EP in aseptically failed total hip arthroplasty (THA) by lower CCL3 and DC-STAMP mRNA and protein expression. EP of all studied inflammatory and osteoclastogenic molecules were similar in knee and hip osteoarthritis (OA). PMID: 25151085
  5. Findings suggest that next-generation sequencing may be helpful in exploring the pathogenesis and aiding the diagnosis of Juvenile Paget's disease. PMID: 25891874
  6. Rs62620995 in the TM7SF4 gene has been found to have a marginal association with Paget's disease of bone in the French-Canadian population. PMID: 24370779
  7. Inhibition of DC-STAMP by RNA interference subsequently suppressed fusion and bone resorption of human osteoclasts. PMID: 23525827
  8. An interaction between OS9 and DC-STAMP was confirmed through yeast-2-hybrid analysis and cellular colocalization. ER-to-Golgi translocation of DC-STAMP following TLR stimulation in CHO cells was demonstrated, involving the DC-STAMP/OS9 interaction. These data indicate that OS9 is critically involved in ER-to-Golgi transport of DC-STAMP and may be important in both myeloid differentiation and cell fusion. PMID: 18952287
  9. DC-STAMP is a potential biomarker for osteoclast precursors in inflammatory arthritis. PMID: 21987375
  10. Research shows that T cells play a pivotal role in a novel in vitro Langhans giant cells (LGCs) formation system, involving DC-STAMP, which occurs through a molecular mechanism involving CD40-CD40L interaction and IFN-gamma secretion. PMID: 22058328
  11. DC-STAMP is an ITIM-bearing molecule. Based on the 4 distinct patterns of DCSTAMP on human peripheral blood mononuclear cells (PBMCs), it has the potential to serve as a susceptible biomarker for psoriasis (Ps) and a severity marker for Psoriatic Arthritis (PsA). PMID: 21987375
  12. Genetic risk for Paget's disease of bone is associated with variants near the CSF1, OPTN, TM7SF4, and TNFRSF11A genes. PMID: 20839008
  13. DC-STAMP interacts with the ER-resident transcription factor LUMAN, which becomes activated during DC maturation. PMID: 20546900
  14. The dendritic cell-specific transmembrane protein is a multimembrane-spanning protein preferentially expressed by human DCs (hDCs). PMID: 15601667
  15. Two differentially expressed genes over-expressed in papillary thyroid cancers were identified as DC-STAMP and type I collagen A1. PMID: 19259350

Show More

Hide All

Database Links

HGNC: 18549

OMIM: 605933

KEGG: hsa:81501

STRING: 9606.ENSP00000297581

UniGene: Hs.652230

Subcellular Location
Cell membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein. Endoplasmic reticulum-Golgi intermediate compartment membrane; Multi-pass membrane protein. Endosome.
Tissue Specificity
Preferentially expressed by dendritic cells (DCs). Detected in both immature and mature DCs. Highly expressed in lymph nodes, lung, kidney and liver. Expressed at lower levels in pancreas, bone marrow, spleen, leukocytes, in freshly isolated peripheral bl

Q&A

What is TM7SF4 and what are its primary biological functions?

TM7SF4 encodes a seven-pass transmembrane protein primarily expressed in dendritic cells, also known as dendritic cell-specific expressed seven transmembrane protein (DC-STAMP). This protein plays crucial roles in regulating immunological functions, osteoclastogenesis, and myeloid differentiation. Recent research has expanded our understanding of TM7SF4's involvement in both normal cellular processes and pathological conditions . The gene's importance is underscored by its conservation across species and its involvement in multiple cellular pathways.

What pathological conditions have been associated with TM7SF4 dysregulation?

TM7SF4 has been implicated in several pathological conditions, most notably Paget's disease of bone (PDB), where its role has been confirmed through extended genome-wide association studies . Additionally, research has identified potential involvement in papillary thyroid cancers. More recently, investigations have revealed TM7SF4's role in breast cancer progression through its impact on cell cycle regulation, suggesting its broader significance in oncogenic processes beyond bone metabolism disorders . These associations highlight TM7SF4 as a potential therapeutic target across multiple disease contexts.

How is TM7SF4 expression regulated across different tissue types?

While TM7SF4 was initially characterized in dendritic cells, research indicates variable expression patterns across tissues. Understanding tissue-specific regulation is critical for contextualizing its role in different pathological conditions. The protein's expression appears to be influenced by both transcriptional and post-transcriptional mechanisms, though comprehensive tissue-specific expression profiles remain an area requiring further investigation. Researchers should consider employing tissue-specific expression analysis when studying TM7SF4's role in various physiological and pathological contexts.

What techniques are recommended for analyzing TM7SF4 genetic variants in clinical samples?

For comprehensive genetic analysis of TM7SF4, next-generation sequencing approaches have proven highly effective. As demonstrated in recent studies, amplicon libraries can be prepared using techniques such as the Ion AmpliSeq Library Kit 2.0, which has achieved 100% coverage of the TM7SF4 coding region . The methodology typically involves:

  • DNA extraction from patient samples

  • Amplicon design targeting the complete coding sequence (using software such as AmpliSeq Designer)

  • Library preparation followed by emulsion PCR with Ion Sphere Particles

  • Sequencing using platforms like Ion Torrent Personal Genome Machine

  • Bioinformatic analysis to identify relevant variants

This approach enables detection of clinically significant variants, as demonstrated in this coverage analysis table:

Target identifiersTarget length (bp)Missed by the assay designer algorithm (bp)Coverage (%)
TM7SF4*14130100
SQSTM113722298.4
TNFRSF11A185119289.63
TNFRSF11B12060100

*also known as DCSTAMP .

What approaches are most effective for studying TM7SF4's functional role in cell cycle regulation?

To investigate TM7SF4's role in cell cycle regulation, particularly in cancer cells, several complementary approaches have proven effective:

  • RNA interference techniques: Small hairpin RNA (shRNA) against TM7SF4 delivered via lentiviral vectors has been successfully employed in breast cancer cell lines

  • Expression analysis: RT-PCR and Western blot analysis to confirm knockdown efficiency

  • Functional assays: Assessment of colony formation, proliferation rates, cell cycle progression, and apoptotic rates following TM7SF4 downregulation

Studies using these approaches in MCF-7 breast cancer cells have demonstrated that TM7SF4 knockdown leads to decreased colony formation, reduced proliferation, disrupted cell cycle progression, and increased apoptosis . These findings establish TM7SF4 as an essential regulator of cell cycle progression in certain cancer contexts and provide a methodological framework for similar investigations in other cell types.

How should researchers design experiments to study TM7SF4 polymorphisms in relation to disease susceptibility?

When investigating TM7SF4 polymorphisms in relation to disease susceptibility, researchers should consider a multi-faceted experimental design:

  • Case-control studies with adequate statistical power

  • Comprehensive genotyping of TM7SF4 variants, particularly focused on functional regions

  • Functional validation of identified variants using in vitro and in vivo models

  • Integration of clinical data with genetic findings

The identification of missense single nucleotide polymorphisms, such as the D349G amino acid change resulting from an A to G substitution at rs3802204, exemplifies the potential significance of TM7SF4 variants . This particular amino acid change, located in the cytoplasmic topological domain, transforms an acidic polar amino acid to an aliphatic non-polar one, potentially affecting protein function. The SIFT score of 0.53 for this variant suggests a potentially tolerated substitution:

GeneTypePloidyReferentVariantAnnotationLocationAmino acid changeSIFT score
TM7SF4†SNPHetAGrs3802204EXON-3D349G0.53

†also known as DCSTAMP .

How does TM7SF4 interact with other factors in osteoclastogenesis and bone metabolism?

TM7SF4 plays a critical role in osteoclastogenesis, though its interactions with other regulatory factors in bone metabolism represent a complex network. While direct interactions between TM7SF4 and other bone metabolism regulators aren't fully detailed in the available research, studies on related pathways provide context for understanding potential interactions. For instance, research on leukotrienes demonstrates their multifarious effects on bone metabolism, including modulation of osteoblastic gene expression in complex ways .

These findings suggest that bone metabolism regulation involves multiple interacting pathways that researchers should consider when studying TM7SF4's role. The high prevalence of pathological fractures (14.0%, 7/50) and osteoarthritis (40.0%, 20/50) in Paget's disease patients further highlights the significance of understanding these metabolic pathways . Investigating TM7SF4's interactions with leukotrienes and other regulators may provide valuable insights into bone metabolism disorders.

What is the molecular mechanism by which TM7SF4 regulates cell cycle progression in cancer cells?

Potential mechanisms worth investigating include:

  • Interaction with cyclins and cyclin-dependent kinases

  • Modulation of apoptotic pathways

  • Influence on transcription factors governing cell cycle progression

  • Interaction with tumor suppressor pathways

Understanding these mechanisms could reveal novel therapeutic approaches for cancers where TM7SF4 plays a significant role, extending beyond current applications in breast cancer research.

How do post-translational modifications affect TM7SF4 function in different cellular contexts?

Post-translational modifications (PTMs) likely play crucial roles in regulating TM7SF4 function across different cellular contexts, though this area remains underexplored. As a seven-pass transmembrane protein with cytoplasmic domains, TM7SF4 contains numerous potential sites for modifications such as phosphorylation, glycosylation, and ubiquitination. The D349G polymorphism, located in the cytoplasmic domain, suggests this region's functional importance and potential involvement in regulatory interactions .

Research methodologies to investigate PTMs of TM7SF4 should include:

  • Mass spectrometry-based proteomics

  • Site-directed mutagenesis of potential modification sites

  • Pharmacological inhibition of specific modification pathways

  • Temporal analysis of modifications under different stimuli

Elucidating these modifications would provide deeper insights into TM7SF4's regulation and potentially reveal context-specific therapeutic approaches.

What are the therapeutic implications of targeting TM7SF4 in Paget's disease of bone?

Given TM7SF4's established role in Paget's disease of bone (PDB), therapeutic approaches targeting this protein represent a promising avenue for treatment. Current PDB management primarily relies on bisphosphonates, with 82.0% of patients receiving intravenous zoledronate and 8.0% receiving oral bisphosphonates in clinical studies . While effective in reducing bone turnover markers, these treatments address symptoms rather than underlying molecular causes.

Targeting TM7SF4 could potentially address the disease's molecular basis. Follow-up data from treated patients showed significant decreases in bone turnover markers after 3-months, 6-months, and 1-year of treatment (P<0.05) . Future therapeutic approaches might include:

  • Small molecule inhibitors targeting TM7SF4's transmembrane domains

  • Biologics targeting TM7SF4 expression or activity

  • Gene therapy approaches to correct TM7SF4 polymorphisms

Such targeted approaches could potentially provide more precise interventions for PDB patients, particularly those with identified TM7SF4 polymorphisms.

How can TM7SF4 genetic variants be integrated into clinical risk assessment for bone disorders?

  • Establishment of robust genotype-phenotype correlations

  • Development of validated risk prediction models incorporating genetic data

  • Standardization of genetic testing methodologies

  • Integration with other known risk factors

The clinical relevance is underscored by findings that 94.0% of PDB patients present with symptoms including bone pain (86.0%), elevated skin temperature over Pagetic bone (26.0%), and bone deformity (22.0%) . Genetic risk assessment could potentially identify patients before symptom onset, facilitating earlier intervention and improved outcomes.

What emerging technologies might advance our understanding of TM7SF4 structure-function relationships?

Emerging technologies that could significantly advance our understanding of TM7SF4 structure-function relationships include:

  • Cryo-electron microscopy for detailed structural analysis of transmembrane domains

  • Single-cell sequencing to elucidate expression patterns in heterogeneous tissues

  • CRISPR-Cas9 genome editing for precise functional analysis of specific domains

  • Advanced proteomics approaches to identify interaction partners

  • Computational modeling to predict functional impacts of polymorphisms

These technologies could help resolve outstanding questions regarding how specific domains of TM7SF4 contribute to its varied functions in immunological processes, osteoclastogenesis, and cell cycle regulation. Particularly, understanding the structural basis for the functional impact of the D349G polymorphism could provide insights into its role in disease susceptibility .

How might multi-omics approaches enhance our understanding of TM7SF4's role in disease pathogenesis?

Integrating multi-omics approaches provides a powerful framework for comprehensively understanding TM7SF4's role in disease pathogenesis. Such integration would involve:

  • Genomics: Identifying and characterizing genetic variants beyond currently known polymorphisms

  • Transcriptomics: Analyzing expression patterns across tissues and disease states

  • Proteomics: Elucidating protein interactions and post-translational modifications

  • Metabolomics: Identifying downstream metabolic alterations associated with TM7SF4 dysfunction

  • Clinical data integration: Correlating molecular findings with phenotypic manifestations

This integrative approach could reveal novel insights into how TM7SF4 contributes to diverse pathological conditions, from Paget's disease of bone to various cancers . The identification of 27 total genetic variants in one targeted genomic analysis highlights the potential complexity of TM7SF4's genetic landscape and the value of comprehensive multi-omics approaches .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.