Recombinant Human Transmembrane and coiled-coil domain-containing protein 1 (TMCO1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. To specify a tag type, please inform us, and we will prioritize its use.
Synonyms
TMCO1; TMCC4; PNAS-10; PNAS-136; UNQ151/PRO177; Calcium load-activated calcium channel; CLAC channel; Transmembrane and coiled-coil domain-containing protein 1; Transmembrane and coiled-coil domains protein 4; Xenogeneic cross-immune protein PCIA3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-188
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
TMCO1
Target Protein Sequence
MSTMFADTLLIVFISVCTALLAEGITWVLVYRTDKYKRLKAEVEKQSKKLEKKKETITES AGRQQKKKIERQEEKLKNNNRDLSMVRMKSMFAIGFCFTALMGMFNSIFDGRVVAKLPFT PLSYIQGLSHRNLLGDDTTDCSFIFLYILCTMSIRQNIQKILGLAPSRAATKQAGGFLGP PPPSGKFS
Uniprot No.

Target Background

Function
TMCO1 is a calcium-selective channel crucial for preventing calcium store overload, thereby maintaining calcium homeostasis. In response to endoplasmic reticulum (ER) stress, it assembles into a homotetrameric calcium channel, regulating ER calcium levels. It is also a component of a ribosome-associated ER translocon complex involved in the transport of multi-pass membrane proteins into the ER membrane and their biogenesis. Working with SEC61 and TMEM147, it forms a lipid-filled cavity within the translocon. TMEM147 may insert hydrophobic segments of multi-pass membrane proteins from the lumen into this central membrane cavity in a SEC61-gated process, while TMCO1 may insert hydrophobic segments of nascent chains from the cytosol into the cavity.
Gene References Into Functions
  1. TMCO1 recruits PHLPP2 to dephosphorylate pAKT1(Ser473). S60 mutagenesis in TMCO1 disrupts cell-cycle arrest and reactivates the AKT pathway. Wild-type TMCO1 overexpression suppresses tumor growth in xenograft mice, while T33A and S60A mutants restore tumor growth. PMID: 28972042
  2. TMCO1 genotype is associated with increased glaucoma risk in non-Hispanic whites. PMID: 27707548
  3. TMCO1, ATOH7, and CAV1 variants are associated with primary open-angle, primary angle-closure, and pseudoexfoliation glaucoma in Pakistani cohorts. PMID: 25489222
  4. TMCO1 deficiency causes autosomal recessive cerebrofaciothoracic dysplasia. PMID: 24194475
  5. Two SNPs (rs7518099 and rs2814471) in TMCO1 are nominally associated with primary open-angle glaucoma. PMID: 23963167
  6. Genetic variation near TMCO1 is associated with age of POAG diagnosis. PMID: 22714896
  7. rs11656696 (GAS7) and rs7555523 (TMCO1) are associated with intraocular pressure (IOP). PMID: 22570627
  8. Genome-wide association study for open-angle glaucoma identified associations at TMCO1 and CDKN2B loci. PMID: 21532571
  9. A TMCO1 sequence variant is associated with a human genetic disorder. PMID: 20018682
Database Links

HGNC: 18188

OMIM: 137760

KEGG: hsa:54499

STRING: 9606.ENSP00000375975

UniGene: Hs.31498

Involvement In Disease
Craniofacial dysmorphism, skeletal anomalies and mental retardation syndrome (CFSMR); Glaucoma, primary open angle (POAG)
Protein Families
TMCO1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein.
Tissue Specificity
Widely expressed in adult and fetal tissues, with higher levels in thymus, prostate, testis and small intestine and lower levels in brain, placenta, lung and kidney. Present in most tissues in the eye, including the trabecular meshwork and retina (at prot

Q&A

What is the normal physiological function of TMCO1?

TMCO1 provides instructions for making a protein that forms specialized calcium channels in the endoplasmic reticulum membrane. When calcium levels become excessive in the endoplasmic reticulum, four TMCO1 proteins assemble to form a functional channel that releases excess calcium into the cytoplasm. This mechanism is essential for maintaining proper calcium balance, which acts as a critical signal for numerous cellular functions including cell growth, division, and gene expression. The proper balance of calcium ions is fundamental for the development and function of various tissues and organs throughout the body .

How is TMCO1 expressed in different tissue types?

TMCO1 shows variable expression patterns across different tissues. In normal physiological conditions, TMCO1 is expressed in most tissues with particularly important roles in skeletal development and ocular tissues. Research has shown differential expression in pathological conditions - notably, TMCO1 levels are significantly decreased in bone specimens from both osteoporosis patients and osteoporotic mice . Conversely, TMCO1 expression is elevated in multiple cancer types including breast cancer, where approximately 70% of TCGA breast cancer patients showed a gain in at least one copy of the TMCO1 gene . Expression analysis using MERAV (a web-based gene expression analysis tool) has confirmed that TMCO1 mRNA expression is higher in breast tumors compared to normal breast tissues .

What experimental approaches can verify TMCO1's calcium channel function?

To investigate TMCO1's function as a calcium channel, researchers can employ several methodological approaches:

  • Calcium imaging using fluorescent indicators (e.g., Fluo-4) to visualize calcium flux

  • Patch-clamp electrophysiology to measure channel conductance

  • Confocal microscopy with calcium-sensitive dyes to track intracellular calcium concentration changes

As demonstrated in studies of A549 lung adenocarcinoma cells, knockdown of TMCO1 resulted in higher intracellular calcium concentration compared to control groups, suggesting impaired calcium homeostasis. Specifically, when TMCO1 was knocked down in A549 cells, confocal microscopy revealed increased intracellular calcium levels, confirming TMCO1's role in calcium regulation .

How do TMCO1 mutations contribute to cerebro-facio-thoracic dysplasia?

At least four TMCO1 gene mutations have been identified that cause cerebro-facio-thoracic dysplasia, characterized by severe intellectual disability, distinctive facial features, and bone abnormalities primarily affecting the ribs and vertebrae. These mutations lead to the production of abnormally short TMCO1 proteins that are quickly degraded. Without functional TMCO1 protein, channels cannot form properly, resulting in excess calcium accumulation in the endoplasmic reticulum. This calcium imbalance disrupts normal development across various tissues and organs, particularly affecting brain development and skeletal formation .

Researchers investigating these mutations should consider:

  • Sequencing approaches to identify specific mutations

  • Protein stability assays to assess degradation rates of mutant proteins

  • Calcium imaging in patient-derived cells to quantify endoplasmic reticulum calcium levels

What is the relationship between TMCO1 and osteoporosis?

Studies using TMCO1 knockout mice have revealed a critical role for this protein in bone development and maintenance. Micro-CT analysis of long bones from Tmco1−/− mice demonstrated dramatic losses in bone mass, thickness, and trabeculation compared to wild-type controls. Quantitative measurements showed significant decreases in:

ParameterChange in Tmco1−/− mice
Trabecular bone volume (BV/TV)Significantly decreased
Bone mineral density (BMD)Significantly decreased
Trabecular thickness (Tb.Th)Significantly decreased
Cortical thickness (C.Th)Significantly decreased
Trabecular spacing (Tb.Sp)Significantly increased

Additionally, bone formation rates were substantially reduced in Tmco1−/− mice, and bone histomorphometric analysis showed decreased osteoblast parameters (Ob.S/BS and N.Ob/B.Pm) in the proximal tibia . These findings indicate that TMCO1 deficiency impairs osteoblast function and bone formation, suggesting a potential mechanism for TMCO1's role in osteoporosis.

How is TMCO1 involved in cancer progression?

TMCO1 demonstrates cancer-specific expression patterns with upregulation in several cancer types. In breast cancer, TMCO1 expression is elevated across multiple subtypes, with protein levels significantly higher in luminal A, luminal B, and basal breast cancer subtypes compared to normal breast tissue . The relationship between TMCO1 expression and prognosis varies by cancer type and context:

  • In node-positive basal breast cancer, higher TMCO1 expression correlates with poorer survival outcomes

  • In lung adenocarcinoma, TMCO1 expression levels are elevated compared to normal lung tissues

  • TMCO1 expression affects different stages of lung adenocarcinoma, with lower expression in stage I compared to other stages

Mechanistically, TMCO1 influences cancer cell behavior through several pathways. In lung adenocarcinoma cells, knockdown of TMCO1:

  • Downregulates B-cell lymphoma-2 (Bcl-2) protein expression

  • Upregulates caspase-3 and caspase-9 protein expression

  • Decreases matrix metalloproteinase (MMP)-2 and MMP-9 expression

  • Reduces N-cadherin and vimentin expression while increasing E-cadherin levels

  • Inhibits cancer cell migration and proliferation

These findings suggest TMCO1 may regulate apoptosis and epithelial-mesenchymal transition in cancer cells, potentially through calcium-dependent signaling pathways.

What are optimal methods for TMCO1 knockdown and overexpression studies?

For effective manipulation of TMCO1 expression in research settings, several validated methodological approaches can be employed:

For TMCO1 knockdown:

  • siRNA-mediated knockdown: Successfully used in A549 lung adenocarcinoma cells as demonstrated by western blotting confirmation of decreased TMCO1 protein levels

  • shRNA-based stable knockdown: Can establish long-term TMCO1 suppression for studying chronic effects

  • CRISPR-Cas9 gene editing: Optimal for complete gene knockout studies

For TMCO1 overexpression:

  • Plasmid-based expression systems with CMV or cell-specific promoters

  • Viral vector delivery (lentivirus, adenovirus) for difficult-to-transfect cells

  • Inducible expression systems for temporal control of TMCO1 levels

When conducting knockdown studies, researchers should verify knockdown efficiency through both mRNA (qRT-PCR) and protein (western blot) analyses, as exemplified in the A549 cell studies where western blotting confirmed successful TMCO1 knockdown .

How can researchers measure the impact of TMCO1 on calcium homeostasis?

To quantify TMCO1's effects on calcium homeostasis, researchers can implement several techniques:

  • Fluorescent calcium indicators: Confocal microscopy with calcium-sensitive dyes like Fluo-4 can visualize real-time changes in intracellular calcium concentration following TMCO1 manipulation. This approach revealed increased cytoplasmic calcium levels in A549 cells after TMCO1 knockdown .

  • Calcium-dependent protein measurements: Analyzing expression changes in calcium-modulated proteins such as CAMKII. Studies in A549 cells showed decreased CAMKII protein expression after TMCO1 knockdown, indicating altered calcium signaling .

  • Patch-clamp electrophysiology: Direct measurement of calcium currents through the endoplasmic reticulum membrane.

  • ER calcium store measurements: Using thapsigargin-induced calcium release to quantify endoplasmic reticulum calcium content.

TechniqueMeasurementAdvantagesLimitations
Calcium fluorescent imagingReal-time Ca²⁺ levelsSpatial resolution, dynamic changesDye loading variability
CAMKII protein expressionDownstream signalingFunctional readoutIndirect measure
Patch-clampDirect channel functionHigh sensitivityTechnical complexity
Thapsigargin responseER Ca²⁺ store contentSpecific to ER storesEndpoint measurement

What cell and animal models are most suitable for TMCO1 research?

Based on current research, several models have proven valuable for investigating TMCO1 function:

Cell Models:

  • A549 lung adenocarcinoma cells: Validated model for TMCO1 knockdown studies with established protocols for assessing effects on apoptosis and migration

  • MDA-MB-231 basal breast cancer cells: Appropriate for studying TMCO1's role in breast cancer, where both nuclear and endoplasmic reticulum localization has been observed

  • Primary osteoblasts: Suitable for investigating TMCO1's role in bone development and calcium regulation

Animal Models:

  • Tmco1−/− knockout mice: Successfully used to study TMCO1's role in bone development, showing significant bone mass reduction and impaired osteoblast function

  • Conditional tissue-specific knockout models: Allow investigation of TMCO1 function in specific tissues while avoiding potential embryonic lethality

When selecting models, researchers should consider that Tmco1−/− mice exhibit variable phenotypes, with approximately 35.4% of pups showing growth retardation and dying before weaning, while surviving adults may not display differences in body size or weight compared to controls .

How does TMCO1 interact with other proteins in calcium homeostasis networks?

TMCO1 functions within a complex network of calcium-regulating proteins. Protein interaction studies have identified several TMCO1-interacting partners, including:

  • Endoplasmic reticulum-resident proteins involved in calcium regulation

  • Proteins directly involved in nucleocytoplasmic transport

These interactions suggest TMCO1 may have functions beyond simple calcium channel activity. In breast cancer cells, TMCO1 has both nuclear and endoplasmic reticulum localization, indicating potential roles in nuclear calcium signaling or gene regulation . Researchers investigating these interactions should consider:

  • Co-immunoprecipitation followed by mass spectrometry for unbiased identification of interacting partners

  • Proximity ligation assays to visualize interactions in intact cells

  • FRET-based approaches to measure direct protein interactions in living cells

Understanding these interactions is critical for elucidating how TMCO1 coordinates with other calcium regulatory systems such as inositol 1,4,5-triphosphate receptors (IP₃Rs), which also play important roles in cancer cell death pathways.

How do TMCO1 expression patterns differ across cancer types and what are the functional implications?

TMCO1 demonstrates cancer-specific expression patterns that vary across tumor types:

  • Increased expression: Observed in gliomas, lung, colon, ovarian, and breast cancers

  • Decreased expression: Reported in urothelial cancers

This differential expression suggests context-dependent roles for TMCO1 in cancer biology. When analyzing such variation, researchers should consider:

  • Genetic mechanisms: In breast cancer, TMCO1 expression positively correlates with gene copy number (Spearman's correlation R-value = 0.6395), suggesting that increased expression results from gene copy number alterations .

  • Subtype-specific patterns: In breast cancer, while TMCO1 protein is elevated across multiple subtypes, basal breast cancers showed modestly lower TMCO1 mRNA levels than Luminal A and Luminal B subtypes .

  • Prognostic significance: Higher TMCO1 expression significantly correlates with poorer survival specifically in node-positive basal breast cancer patients, but not in Luminal A, Luminal B, or HER2 subtypes .

These patterns suggest that while TMCO1 overexpression may be a general feature of many cancers, its functional impact and prognostic value are likely cancer type and subtype-specific.

What role does TMCO1 play in regulating cell death pathways in cancer?

TMCO1 appears to influence cancer cell apoptosis through calcium-dependent mechanisms. Research findings demonstrate:

  • In lung adenocarcinoma cells, TMCO1 knockdown resulted in:

    • Significantly decreased Bcl-2 expression (anti-apoptotic protein)

    • Significantly increased caspase-3 and caspase-9 expression (pro-apoptotic proteins)

    • Reduced cell activity as measured by MTT assay

  • In breast cancer cells, TMCO1 regulates sensitivity to BCL-2/MCL-1 inhibitors, similar to the role of inositol 1,4,5-triphosphate receptors in cell death pathways .

These findings suggest TMCO1 may function as a regulator of the apoptotic threshold in cancer cells, potentially through calcium-mediated signaling. The Ca²⁺ leak function of TMCO1 appears to mimic some features of leaky IP₃Rs, which are linked to the remodeling of cell death pathways in cancer cells .

Researchers investigating this connection should consider apoptosis assays such as Annexin V/PI staining, caspase activity measurements, and mitochondrial membrane potential assessments in conjunction with TMCO1 manipulation.

What therapeutic opportunities might targeting TMCO1 present?

Given TMCO1's role in calcium homeostasis and its altered expression in various diseases, several therapeutic opportunities warrant investigation:

  • Cancer therapy: In cancers where TMCO1 is overexpressed, such as breast and lung cancer, targeted inhibition might enhance sensitivity to existing treatments. TMCO1 inhibition could potentially synergize with BCL-2/MCL-1 inhibitors in breast cancer treatment .

  • Osteoporosis treatment: As TMCO1 deficiency is associated with bone loss, approaches to restore or enhance TMCO1 function might represent a novel strategy for treating osteoporosis .

  • Glaucoma management: Given TMCO1's association with primary open-angle glaucoma, particularly in populations of European descent, targeting TMCO1 pathways might offer new approaches for managing this common cause of vision loss .

Research approaches should include:

  • Small molecule screening for TMCO1 modulators

  • Structure-based drug design targeting the calcium channel function

  • Gene therapy approaches for conditions caused by TMCO1 deficiency

How can contradictory findings regarding TMCO1 in different disease contexts be reconciled?

TMCO1 exhibits seemingly contradictory roles across different pathological contexts:

  • Decreased in osteoporosis, associated with bone loss

  • Increased in multiple cancer types, often correlating with poor outcomes

  • Both gain and loss of function can lead to pathology in different tissues

These apparent contradictions likely reflect the tissue-specific and context-dependent nature of calcium signaling. Researchers seeking to reconcile these findings should consider:

  • Tissue-specific calcium requirements: Different tissues may have unique calcium homeostasis needs and signaling pathways.

  • Compensatory mechanisms: Alternative calcium channels or regulators may compensate for TMCO1 dysfunction differently across tissues.

  • Interaction networks: TMCO1's protein interaction partners likely differ between tissues, altering its functional impact.

  • Methodological approaches for cross-disease comparison:

    • Single-cell analyses to identify cell type-specific effects

    • Systems biology approaches to model calcium signaling networks

    • Comparative proteomics to identify tissue-specific interaction partners

Understanding these contextual differences will be essential for developing targeted therapeutic approaches without triggering unintended consequences in other tissues.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.