Recombinant Human Transmembrane and coiled-coil domain-containing protein 2 (TMCO2)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Human Transmembrane and coiled-coil domain-containing protein 2 (TMCO2) is a protein encoded by the TMCO2 gene in humans . TMCO2 is characterized as an integral membrane protein featuring transmembrane and coiled-coil domains . Research suggests its involvement in various cellular functions and associations with certain diseases .

Basic Information

FeatureDescription
Protein TypeIntegral membrane protein
Gene SymbolTMCO2
Molecular Weight20,331 Da
Isoelectric Point8.96
Chromosomal LocationChromosome 1
Mouse Ortholog Location4
Cellular ComponentMembrane
Alternative Names1700028F16Rik, OTTMUSP00000009277, Tmco2, Transmembrane and coiled-coil domain-containing protein 2, transmembrane and coiled-coil domains 2

TMCO2 has cross-references in databases such as AlphaFold, STRING, BioGPS, Pfam, Phospho.ELM, NetworKIN, UniProtKB, Entrez-Gene, and Ensembl Gene .

Structure and Domains

TMCO2 contains transmembrane domains, which facilitate its integration into cellular membranes, and coiled-coil domains, which are known for mediating protein-protein interactions . These domains are crucial for its function and localization within the cell .

Cellular Localization

TMCO2 is located in the endoplasmic reticulum (ER) through its C-terminal transmembrane domains, with its N-terminal region and C-terminal tail residing in the cytoplasm . Studies using GFP-tagged TMCC1 (transmembrane and coiled-coil domain family 1), which has similar structural features, showed that the C-terminal transmembrane domains are essential for ER targeting .

Expression in Cancer

TMCO2 expression has been studied in various cancer tissues . Data from The Cancer Genome Atlas (TCGA) provides RNA-seq data, reporting median FPKM (number Fragments Per Kilobase of exon per Million reads) values across 17 cancer types . Antibody staining in 20 different cancers reveals the protein expression patterns, with representative images available for colorectal, breast, prostate, and lung cancers .

Role in Brain Development

Genetic studies have identified TMCO2 as one of the genes influencing structural changes in the brain . Specifically, TMCO2 is associated with changes in lateral ventricle volume, suggesting a role in brain development and morphology .

Multi-Omics Research

TMCO2 appears in multi-omics datasets, which combine two or more omics data sets to aid in data analysis . These datasets are valuable for comprehensive biological studies but require careful statistical and technical characterization to account for potential confounders and batch effects .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
TMCO2; Transmembrane and coiled-coil domain-containing protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-182
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
TMCO2
Target Protein Sequence
MSTSSSSSWDNLLESLSLSTVWNWIQASFLGETSAPQQTSLGLLDNLAPAVQIILRISFL ILLGIGIYALWKRSIQSIQKTLLFVITLYKLYKKGSHIFEALLANPEGSGLRIQDNNNLF LSLGLQEKILKKLKTVENKMKNLEGIIVAQKPATKRDCSSEPYCSCSDCQSPLSTSGFTS PI
Uniprot No.

Target Background

Database Links

HGNC: 23312

KEGG: hsa:127391

STRING: 9606.ENSP00000361852

UniGene: Hs.406265

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is TMCO2 and where is it encoded in the human genome?

TMCO2 (Transmembrane and Coiled-coil Domains 2) is a protein-coding gene located on chromosome 1 in humans. The gene encodes a protein that contains transmembrane regions and coiled-coil domains, which are structural motifs important for protein-protein interactions and membrane integration . Understanding the genomic location is essential for genetic analysis studies, especially when investigating potential mutations or polymorphisms that might affect TMCO2 function.

What alternative identifiers are used for TMCO2 in scientific databases?

TMCO2 is also known by the alternative identifier dJ39G22.2 in some scientific databases and literature . When conducting literature searches or database queries, researchers should include these alternative identifiers to ensure comprehensive results and avoid missing relevant publications or data entries.

What is the basic structural composition of the TMCO2 protein?

As the name suggests, TMCO2 contains transmembrane domains that anchor the protein within cellular membranes and coiled-coil domains that typically mediate protein-protein interactions . The combination of these structural elements suggests TMCO2 may function in membrane-associated protein complexes, potentially involved in cellular signaling, transport, or structural organization of membrane compartments. Detailed structural analysis through crystallography or cryo-EM would provide additional insights into its three-dimensional configuration.

What RNA interference approaches can be employed to study TMCO2 function?

Small interfering RNA (siRNA) targeting TMCO2 is an effective approach for studying its function through gene knockdown. The siRNA interferes with TMCO2 expression by binding to complementary nucleotide sequences in its mRNA, leading to degradation after transcription and preventing translation into protein . This methodology allows researchers to observe phenotypic changes resulting from reduced TMCO2 expression, providing insights into its functional roles within cells.

What modifications can enhance siRNA efficacy when targeting TMCO2?

Ribo-modified siRNAs targeting TMCO2 have been developed to provide increased stability, enhanced specificity, and reduced immunogenicity compared to unmodified siRNAs . These modifications extend the half-life of siRNAs in cellular and in vivo environments, allowing for more sustained knockdown effects. Additionally, they help minimize off-target effects and immune responses that could confound experimental results. When designing TMCO2 knockdown experiments, researchers should consider these modifications to optimize their approach.

How should researchers design experimental controls for TMCO2 expression studies?

Proper experimental design for TMCO2 studies should include multiple controls: (1) non-targeting siRNA controls with similar chemical modifications to test for non-specific effects, (2) positive controls targeting a well-characterized gene to confirm transfection efficiency, (3) untreated controls to establish baseline expression levels, and (4) validation of knockdown efficiency through qPCR and western blotting. This comprehensive approach ensures that observed phenotypes can be reliably attributed to TMCO2 knockdown rather than experimental artifacts.

What purification methods are optimal for recombinant TMCO2 protein production?

For purification of recombinant TMCO2, High-Performance Liquid Chromatography (HPLC) is recommended as indicated in available research protocols . The purification strategy should account for TMCO2's transmembrane domains, which may affect solubility. Approaches might include using detergents during extraction and purification, employing affinity tags that can be specifically cleaved post-purification, and implementing multiple chromatography steps to achieve high purity. Researchers should validate purified protein by SDS-PAGE, western blotting, and mass spectrometry.

What expression systems are most effective for producing functional recombinant TMCO2?

When selecting an expression system for recombinant TMCO2, researchers should consider that membrane proteins often require eukaryotic expression systems to ensure proper folding and post-translational modifications. Mammalian cell lines (HEK293, CHO), insect cells (Sf9, High Five), or yeast systems (Pichia pastoris) may be more suitable than bacterial systems for producing functional TMCO2. Each system offers different advantages regarding yield, post-translational modifications, and membrane protein folding capacity.

How can researchers effectively validate TMCO2 knockdown in experimental models?

Validation of TMCO2 knockdown should employ multiple complementary approaches. Quantitative PCR can measure mRNA reduction, while western blotting confirms protein level changes. For transmembrane proteins like TMCO2, immunofluorescence microscopy provides additional confirmation by visualizing changes in protein localization and abundance within cellular compartments. For definitive functional validation, researchers should also demonstrate rescue of knockdown phenotypes through expression of siRNA-resistant TMCO2 variants.

What are key considerations when investigating TMCO2 protein-protein interactions?

When studying TMCO2 interactions, researchers should account for its transmembrane nature. Appropriate methods include co-immunoprecipitation with membrane-compatible detergents, proximity labeling approaches (BioID, APEX), or split-protein complementation assays optimized for membrane proteins. Due to TMCO2's coiled-coil domains, which typically mediate protein interactions, researchers should carefully design constructs that preserve these domains while enabling detection through epitope tags or fusion proteins.

How should researchers approach TMCO2 localization studies within cellular compartments?

For accurate subcellular localization of TMCO2, researchers should employ multiple complementary techniques. Immunofluorescence with validated antibodies against endogenous TMCO2 provides the most physiologically relevant data. This can be supplemented with expression of fluorescently tagged TMCO2, though care must be taken to ensure tags don't disrupt localization signals. Co-localization studies with established markers for various membrane compartments (ER, Golgi, plasma membrane) will provide context for TMCO2 function.

What experimental approaches can determine TMCO2's topology within membranes?

Determining TMCO2's membrane topology (orientation of protein domains relative to the membrane) requires specialized approaches. Protease protection assays combined with domain-specific antibodies can reveal which regions are accessible from different membrane sides. Alternatively, fluorescence protease protection (FPP) assays using GFP-tagged constructs or glycosylation mapping strategies can provide insights into which domains reside in the cytosol, within the membrane, or in luminal compartments.

How should researchers interpret changes in TMCO2 expression across different experimental conditions?

When analyzing TMCO2 expression changes, researchers should consider both statistical and biological significance. Changes should be normalized to appropriate housekeeping genes when measuring mRNA or to loading controls for protein quantification. Time-course experiments may reveal transient changes that could be missed in single time-point analyses. Researchers should also consider whether changes in TMCO2 are primary effects or secondary consequences of other cellular processes affected by experimental conditions.

What approaches can help resolve contradictory findings in TMCO2 research?

When confronted with contradictory findings regarding TMCO2 function, researchers should systematically evaluate experimental differences. These may include: (1) cell type-specific effects, (2) differences in knockdown efficiency or timing, (3) variations in experimental conditions or assay sensitivity, and (4) potential compensatory mechanisms in different model systems. Meta-analysis approaches combining data from multiple studies can also help identify consistent patterns amid seemingly contradictory results.

How can genomic databases be effectively utilized for TMCO2 research?

Researchers investigating TMCO2 should leverage genomic databases to understand its conservation across species, identify potential functional domains, and explore expression patterns across tissues and conditions. NCBI RefSeq provides reference sequences (e.g., NM_001008740.3) that should be used as standards when designing primers, probes, or targeting constructs. Databases like GTEx (for tissue expression), COSMIC (for cancer mutations), or gnomAD (for population variants) can provide valuable context for experimental findings and guide hypothesis generation.

What are the considerations for developing gene therapy approaches targeting TMCO2?

When developing gene therapy approaches involving TMCO2, researchers must consider delivery methods appropriate for the target tissue, potential off-target effects, and immune responses. RNA interference strategies using modified siRNAs have shown promise in regulating TMCO2 expression . These modifications provide increased stability, specificity, and reduced immunogenicity, making them potential candidates for therapeutic applications. Comprehensive safety profiling and efficacy testing in relevant disease models would be essential steps in translating TMCO2-targeted therapies to clinical applications.

How can CRISPR-Cas9 technology be applied to study TMCO2 function?

CRISPR-Cas9 offers several advantages over siRNA for studying TMCO2, including complete gene knockout rather than temporary knockdown. Researchers should design guide RNAs targeting conserved exons or critical functional domains, and include appropriate controls to account for off-target effects. For more nuanced studies, CRISPR interference (CRISPRi) or CRISPR activation (CRISPRa) can modulate TMCO2 expression without editing the genome. CRISPR knock-in approaches can also introduce tags for visualization or specific mutations to study structure-function relationships.

What high-throughput screening approaches can identify modulators of TMCO2 function?

High-throughput screens to identify TMCO2 modulators might employ cell-based assays with reporter systems linked to TMCO2 expression or function. For example, cells could be engineered with luminescent or fluorescent reporters downstream of TMCO2-dependent pathways. Alternatively, phenotypic screens could identify compounds that mimic TMCO2 knockdown effects. More targeted approaches might include in silico screening for compounds predicted to bind TMCO2 based on structural modeling, followed by validation in biochemical assays measuring TMCO2 activity or interactions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.