Recombinant Human Transmembrane and coiled-coil domain-containing protein 5B (TMCO5B)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
TMCO5B; Transmembrane and coiled-coil domain-containing protein 5B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-307
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
TMCO5B
Target Protein Sequence
MEDVGQNPLDDVKNIFFASSLEAVKQNLDCLNSDLEKDLQKLDMENQVLLRKIKEKEETI SSLERKLALSLEEAKEEEELNYVIDEQEESLRELELETAKLEKSNAILSRNVVEVQKKIS GLFTNIGLEEETTKQILEEMKARLQKSTESCAKQEEELAKIESDYQSVSDLCKDQVYYIK KYQEVLRKMKEEKETLLLEKQISKAQDDSSQTVKPGSILADTTQRNMERTTIKKQERRCW YKYFQYLTFMVLVFIRLLAYVIFHLQYINPDLLVDVLPLVLSRGTLESLRKVSHPFLTLA VEEALPH
Uniprot No.

Target Background

Database Links

HGNC: 34243

UniGene: Hs.439998

Protein Families
TMCO5 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the domain structure of TMCO5B and how does it compare to other TMCO family proteins?

TMCO5B belongs to the Transmembrane and Coiled-coil domains (TMCO) gene family. Like its paralog TMCO5A, it contains a characteristic N-terminal coiled-coil domain and a C-terminal transmembrane domain. The coiled-coil domain allows for protein-protein interactions and potential oligomerization, while the transmembrane domain anchors the protein to cellular membranes.

The domain architecture distinguishes TMCO proteins from other membrane proteins:

DomainLocationPredicted FunctionConservation
Coiled-coilN-terminalProtein-protein interactions, potential oligomerizationModerately conserved
TransmembraneC-terminalMembrane anchoringHighly conserved

The coiled-coil domains in TMCO proteins share structural similarities with other coiled-coil containing proteins that function in cellular organization, particularly those involved in vesicle transport and cytoskeletal interactions .

How can researchers accurately predict the oligomerization state of TMCO5B's coiled-coil domain?

Predicting the oligomerization state of TMCO5B's coiled-coil domain requires analysis of specific sequence determinants rather than relying solely on general prediction tools. Research has shown that oligomerization state is controlled by trigger sequences - elements indispensable for coiled-coil formation.

To accurately predict oligomerization:

  • Identify potential trigger sequences within the coiled-coil domain

  • Analyze for specific oligomerization-state determinants (such as R-IxxIE motifs for trimers)

  • Consider the position of these determinants, particularly if they fall within trigger sequences

  • Evaluate the presence of competing determinants that may influence oligomerization

Studies of other coiled-coil proteins have demonstrated that even well-established oligomerization-state determinants only effectively switch topology when inserted into trigger sequences. Multiple determinants can coexist in the same trigger sequence, creating a delicate balance determined by position-dependent forces .

What is the optimal approach for designing experiments to study TMCO5B function?

A robust experimental design for studying TMCO5B function should follow these key steps:

  • Define your variables precisely:

    • Independent variable: TMCO5B expression levels, mutations, or interactions

    • Dependent variable: Cellular phenotypes, protein localization, or binding affinities

    • Control variables: Cell type, temperature, expression of other proteins

  • Formulate a specific, testable hypothesis about TMCO5B function based on its domain structure and previous findings about TMCO family proteins .

  • Design experimental treatments:

    • Expression vectors with wild-type and mutant TMCO5B

    • Knockdown or knockout strategies

    • Varying experimental conditions that might affect function

  • Assign subjects to appropriate groups:

    • Between-subjects design: Different cell lines or samples receive different treatments

    • Within-subjects design: Same samples measured under different conditions over time

  • Measure dependent variables precisely:

    • Quantitative assays for protein function

    • Imaging techniques for localization studies

    • Biochemical assays for interaction studies

This experimental design maximizes internal validity while allowing for meaningful exploration of TMCO5B function in cellular contexts .

What techniques are most effective for studying TMCO5B localization in cellular structures?

Determining TMCO5B localization requires complementary approaches to ensure accurate results:

  • Immunofluorescence microscopy:

    • Generate specific monoclonal antibodies against recombinant TMCO5B

    • Use co-localization studies with markers for cellular compartments (e.g., β-tubulin for microtubules)

    • Apply super-resolution techniques for detailed subcellular localization

  • Biochemical fractionation:

    • Separate cellular components through differential centrifugation

    • Analyze TMCO5B distribution across fractions via immunoblotting

    • Compare with known markers of cellular compartments

  • Live-cell imaging approaches:

    • Create fluorescent protein fusions with TMCO5B

    • Perform time-lapse imaging to track dynamic localization

    • Use photobleaching techniques (FRAP/FLIP) to assess protein mobility

When examining TMCO5 localization, researchers found that it co-localizes with β-tubulin in the manchette, a transient structure in spermatids. This localization was confirmed through double immunofluorescence studies comparing the distribution of TMCO5 and β-tubulin .

How should researchers interpret differences in temporal expression patterns of TMCO5B across different tissues?

Interpreting temporal expression patterns of TMCO5B requires systematic analysis and consideration of developmental and physiological contexts:

  • Establish a timeline of expression:

    • Analyze expression at different developmental stages

    • Use both transcriptional (mRNA) and translational (protein) level analyses

    • Compare with known developmental markers

  • Consider tissue-specific factors:

    • Evaluate potential transcriptional regulators in different tissues

    • Analyze the presence of tissue-specific splice variants

    • Assess post-transcriptional regulation mechanisms

  • Address discrepancies between mRNA and protein expression:

    • Investigate potential time-lags between transcription and translation

    • Consider protein stability and degradation rates

    • Evaluate translational regulation mechanisms

Research on TMCO5 demonstrated a significant time-lag between mRNA expression (detected in round spermatids) and protein expression (detected only in step 9-12 elongating spermatids). This pattern reflects the transcriptional decline during chromatin condensation in spermatids, where transcripts are stored in a translationally repressed state until needed. Species-specific differences in expression timing may also occur, as seen between mouse and rat TMCO5 .

How can researchers determine if TMCO5B functions in vesicle transport along the manchette or other cellular structures?

To investigate TMCO5B's potential role in vesicle transport, researchers should employ a multi-faceted approach:

  • Colocalization studies with vesicle transport markers:

    • Examine overlap with Golgi-derived vesicle markers

    • Analyze colocalization with motor proteins (kinesins, dyneins)

    • Investigate association with regulatory molecules (Rab proteins)

  • Live-cell imaging of vesicle trafficking:

    • Create fluorescently-tagged TMCO5B constructs

    • Track movement of TMCO5B-positive structures in real-time

    • Measure velocity and directionality of transport

  • Functional perturbation experiments:

    • Generate TMCO5B mutants lacking specific domains

    • Perform knockdown/knockout studies

    • Analyze effects on vesicle formation and movement

  • Reconstitution assays:

    • Express TMCO5B in heterologous systems (e.g., CHO cells)

    • Observe effects on Golgi organization and vesicle transport

    • Test for interactions with microtubules and vesicle components

Studies with TMCO5 in CHO cells demonstrated that induced expression resulted in co-localization with β-tubulin and reorganization of the Golgi apparatus, supporting its potential role in vesicle transport. The protein's localization to the manchette, a structure serving in transport of Golgi-derived non-acrosomal vesicles, further supports this function .

What approach should be used to investigate potential interactions between TMCO5B and microtubule structures?

Investigating TMCO5B-microtubule interactions requires specialized techniques:

  • In vitro binding assays:

    • Purify recombinant TMCO5B and tubulin

    • Perform co-sedimentation assays with polymerized microtubules

    • Use surface plasmon resonance to measure binding kinetics

  • Structural studies:

    • Identify potential microtubule-binding domains in TMCO5B

    • Generate truncated constructs to map interaction sites

    • Use cryo-electron microscopy to visualize binding interfaces

  • Cell-based assays:

    • Examine effects of microtubule-disrupting drugs on TMCO5B localization

    • Perform proximity ligation assays to detect in situ interactions

    • Use FRET/BRET to assess direct protein-protein interactions

  • Functional consequences:

    • Evaluate how TMCO5B affects microtubule dynamics

    • Assess impact of TMCO5B on microtubule-dependent transport

    • Investigate potential regulation of microtubule organization

Research on TMCO5 showed that while it co-localizes with β-tubulin in the manchette, its distribution is not completely consistent with that of β-tubulin, suggesting a complex relationship beyond simple binding. The protein appears absent from the most posterior part of the microtubule structure, indicating potential functional specialization in specific regions .

What is the recommended approach for developing and validating monoclonal antibodies against TMCO5B?

Developing reliable monoclonal antibodies against TMCO5B requires rigorous methodology:

  • Antigen design and production:

    • Select unique regions of TMCO5B with high antigenicity

    • Express and purify recombinant protein fragments

    • Verify antigen quality through SDS-PAGE and mass spectrometry

  • Immunization and hybridoma generation:

    • Immunize animals (rats/mice) with purified antigen

    • Harvest spleen cells and fuse with myeloma cells

    • Screen hybridomas through ELISA against recombinant protein

  • Comprehensive validation strategy:

    • Test antibody specificity via immunoblotting on tissues with/without TMCO5B

    • Perform immunohistochemistry on tissues with known expression patterns

    • Include negative controls (pre-immune serum, secondary antibody only)

    • Validate in knockout/knockdown systems when available

  • Cross-reactivity assessment:

    • Test against related TMCO family proteins

    • Evaluate species cross-reactivity if working across model organisms

    • Determine epitope specificity through peptide competition assays

An effective approach used for TMCO5 involved generating monoclonal antibodies against a partial recombinant protein (amino acids 162-536). Hybridomas were screened by both ELISA and immunohistochemistry on tissue sections, then further cloned by limited dilution. The resulting antibody showed high specificity as demonstrated by age-dependent and tissue-specific immunoblotting results .

How can researchers address contradictory results in TMCO5B localization studies?

When faced with contradictory localization results, researchers should implement a systematic troubleshooting approach:

  • Evaluate methodological differences:

    • Compare fixation protocols (different fixatives may preserve structures differently)

    • Assess permeabilization methods (affecting antibody accessibility)

    • Review detection systems (direct vs. indirect immunofluorescence)

  • Analyze antibody characteristics:

    • Compare antibodies targeting different epitopes of TMCO5B

    • Consider potential recognition of three-dimensional vs. linear epitopes

    • Assess antibody specificity through appropriate controls

  • Account for biological variables:

    • Examine potential developmental stage differences

    • Consider cell type-specific variations in localization

    • Evaluate species-specific differences in localization patterns

  • Implement complementary approaches:

    • Use multiple detection methods (immunofluorescence, electron microscopy)

    • Employ tagged protein expression systems

    • Perform fractionation studies to complement imaging

Research on TMCO5 revealed discrepancies between studies in rats and mice regarding temporal expression patterns. These differences were attributed to either species-specific variations in spermatogenesis timing (cycle length: 233.6h in mice vs. 310.8h in rats) or antibody properties (polyclonal antibodies against oligopeptides vs. monoclonal antibodies against larger protein fragments) .

What data table formats are most effective for presenting TMCO5B experimental results?

Effective data presentation for TMCO5B research requires carefully designed tables that clearly communicate findings:

  • Expression analysis tables:

    • Organize by tissue type and developmental stage

    • Include both mRNA and protein quantification

    • Present relative expression values with statistical significance

Example table format for expression analysis:

TissueDevelopmental StageTMCO5B mRNA (Relative Units)TMCO5B Protein (Relative Units)Statistical Significance
Testis2 weeks0.12 ± 0.03Not detected-
Testis3 weeks0.45 ± 0.08Not detectedp<0.05 vs 2 weeks
Testis4 weeks1.25 ± 0.150.32 ± 0.05p<0.01 vs 3 weeks
TestisAdult1.86 ± 0.211.00 ± 0.12p<0.01 vs 4 weeks
  • Localization study tables:

    • List subcellular compartments

    • Include co-localization coefficients with marker proteins

    • Present data from multiple detection methods

  • Interaction study tables:

    • List interacting proteins

    • Include interaction strength measurements

    • Present binding affinities and statistical significance

For proper table formatting:

  • Place the title at the top of the table with clear description

  • Identify independent variables (left columns) and dependent variables (right columns)

  • Include appropriate units for all measurements

  • Provide statistical analysis information

  • Use consistent decimal places for numerical data4

What statistical approaches are most appropriate for analyzing TMCO5B experimental data?

Selecting appropriate statistical methods for TMCO5B research depends on the experimental design and data characteristics:

  • For expression analysis:

    • Use ANOVA for comparing expression across multiple tissues/timepoints

    • Apply post-hoc tests (Tukey's, Bonferroni) for pairwise comparisons

    • Implement non-parametric alternatives (Kruskal-Wallis) for non-normal distributions

  • For colocalization studies:

    • Calculate Pearson's or Mander's correlation coefficients

    • Use randomization tests to establish significance thresholds

    • Implement object-based colocalization analysis for discrete structures

  • For binding/interaction studies:

    • Fit binding data to appropriate models (e.g., one-site binding)

    • Calculate affinity constants (Kd) with confidence intervals

    • Use statistical tests appropriate for replicate experiments

  • For knockdown/overexpression studies:

    • Apply t-tests for simple comparisons between two conditions

    • Use regression analysis for dose-response relationships

    • Implement mixed models for repeated measures designs

When analyzing data tables:

  • Always state sample sizes (n) clearly

  • Report both central tendency (mean/median) and dispersion (SD/SEM)

  • Specify the statistical tests used and p-value thresholds

  • Consider multiple testing corrections when appropriate

  • Validate assumptions of statistical tests (normality, homogeneity of variance)

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.