Recombinant Human Transmembrane and coiled-coil domain-containing protein 6 (TMCO6)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.

Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.

Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.

Note: While the tag type is determined during production, please specify your required tag type in advance to prioritize its use in the manufacturing process.
Synonyms
TMCO6; PRO1580; Transmembrane and coiled-coil domain-containing protein 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-493
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
TMCO6
Target Protein Sequence
MWSRRQGRLRPTVCGVEELRRRRREREAALRKARREQQLVSKRLLRNDAPEEAGEGCVAA ILGETEVQQFLRQAQRGTEEKEREGALVSLRRGLQHPETQQTFIRLEGSMRTLVGLLTSN QALLQLEAARCLHELSHSEQSTVAEACLPATSYLLTYLSSHSSDFIELCLYTLGNLIVES EAVRRQLLPQGIVPALAACIQSPHVAVLEALGYALSQLLQAEEAPEKIIPSILASTLPQH MLQMLQPGPKLNPGVAVEFAWCLHYIICSQVSNPLLIGHGALSTLGLLLLDLAGAVQKTE DAGLELLACPVLRCLSNLLTEAAVETVGGQMQLRDERVVAALFILLQFFFQKQPSLLPEG LWLLNNLTANSPSFCTSLLSLDLIEPLLQLLPVSNVVSVMVLTVLCNVAEKGPAYCQRLW PGPLLPALLHTLAFSDTEVVGQSLELLHLLFLYQPEAVQVFLQQSGLQALERHQEEAQLQ DRVYALQQTALQG
Uniprot No.

Target Background

Database Links

HGNC: 28814

KEGG: hsa:55374

UniGene: Hs.534333

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the genomic location and organization of the TMCO6 gene?

The human TMCO6 gene is located on chromosome 5 at position 5q31.3. It spans 5568 base pairs on the positive strand of chromosome 5 (genomic coordinates 140019113-140024689bp). The gene undergoes alternative splicing to produce different variants. There are three confirmed variants, with variant 1 being the longest, and several predicted variants (X1-X7) . Understanding the genomic organization is essential for designing targeted genetic studies, including CRISPR-Cas9 approaches for functional analysis.

What are the key structural domains and motifs in the TMCO6 protein?

TMCO6 contains several important structural features critical for its function:

  • Two reserved ARM superfamily domains (Armadillo/beta-catenin-like-repeat), approximately 40 amino acids long, forming a superhelix of helices

  • Arginine-rich region within the coiled-coil domain, likely an important structural feature

  • Two transmembrane domains

  • An SRP1 domain (Karyopherin/importin alpha) from amino acids 23-399, involved in nuclear-cytoplasmic transport

  • Di-leucine motifs, commonly known as lysosome targeting motifs

  • A nuclear localization sequence consisting of 5 positive amino acids near the 5' end

When designing recombinant constructs, researchers should consider preserving these domains to maintain native protein function.

What expression patterns does TMCO6 exhibit in human tissues?

TMCO6 shows specific tissue expression patterns, with highest expression reported in liver tissue during fetal development in humans . When designing experiments to study TMCO6 function, researchers should consider using appropriate cell lines that reflect the protein's natural expression environment. Liver-derived cell lines or primary hepatocytes may be particularly suitable for functional studies.

How conserved is TMCO6 across species?

Orthologs of TMCO6 have been identified in numerous vertebrate species, from primates to fish, but are notably absent in invertebrates, fungi, plants, and bacteria . Evolutionary rate analysis indicates that TMCO6 is a relatively fast-evolving protein, with a rate of evolution comparable to fibrinogen . This information is valuable when selecting model organisms for TMCO6 research, suggesting that vertebrate models would be most appropriate.

What methodological approaches are recommended for cross-species functional studies of TMCO6?

When conducting comparative studies:

  • Sequence alignment tools (BLAST, Clustal Omega) should be used to identify conserved regions that may be functionally important

  • Phylogenetic analysis can help trace evolutionary relationships and functional divergence

  • For functional complementation studies, consider that the fast evolutionary rate of TMCO6 may affect cross-species compatibility

  • When designing antibodies or probes for cross-species detection, target the most conserved epitopes

What is the subcellular localization of TMCO6 and how can it be experimentally determined?

TMCO6 is a multi-pass membrane protein with evidence of presence in multiple subcellular compartments, including the nucleus, cytosol, endoplasmic reticulum, mitochondria, and plasma membrane . The protein's 5' and 3' ends are predicted to be located on the cytoplasmic side of the membrane, with a small portion in the non-cytoplasmic region .

To experimentally determine localization:

  • Immunofluorescence microscopy with compartment-specific markers

  • Subcellular fractionation followed by Western blotting

  • Expression of fluorescently-tagged TMCO6 constructs, taking care that tags do not interfere with localization signals

  • Electron microscopy with immunogold labeling for high-resolution localization

What expression systems are optimal for producing recombinant TMCO6?

When expressing recombinant TMCO6:

  • Mammalian expression systems (HEK293, CHO cells) are recommended for proper folding and post-translational modifications

  • Use of adenoviral expression systems has been validated (as evidenced by commercially available TMCO6 adenovirus)

  • Include affinity tags (His, Myc) for purification and detection, positioned to avoid interference with functional domains

  • Consider codon optimization for the expression system being used

  • For membrane protein expression, detergent screening is critical for solubilization while maintaining protein structure

What is the role of TMCO6 in nuclear transport?

Based on its domain structure, TMCO6 is thought to be involved in the transport of molecules through the nuclear membrane . The SRP1 domain (amino acids 23-399) encodes alpha-Karyopherin (importin) and is associated with intracellular trafficking and membrane secretion .

Methodological approaches to study this function include:

  • Nuclear import/export assays using fluorescently labeled cargo molecules

  • Protein-protein interaction studies with nuclear pore complex components

  • FRAP (Fluorescence Recovery After Photobleaching) to measure nuclear transport kinetics

  • RNA interference or CRISPR knockout studies to assess the impact on nuclear transport

How does TMCO6 interact with the mitochondrial respiratory chain?

Homozygous recessive sequence variants in TMCO6 have been identified in patients with mitochondrial disease, suggesting a potential role in the assembly pathways of Complex I (CI) of the mitochondrial respiratory chain .

To investigate this function:

  • Measure respiratory chain complex activities in TMCO6-deficient cells

  • Assess mitochondrial membrane potential and ATP production

  • Perform blue native PAGE to analyze assembly of respiratory chain complexes

  • Use proximity labeling techniques (BioID, APEX) to identify mitochondrial interaction partners

  • Complement patient-derived cells with wild-type TMCO6 to confirm causality

What is the mechanism by which TMCO6 mediates CD8+ T cell dysfunction in hepatocellular carcinoma?

Recent research has revealed that TMCO6 plays a critical role in immune regulation in the context of hepatocellular carcinoma (HCC):

  • DNA from neutrophil extracellular traps (NET-DNA) binds to TMCO6 on CD8+ T cells

  • The N-terminus of TMCO6 interacts with NET-DNA

  • This interaction suppresses T-cell receptor signaling and NFκB p65 nuclear translocation

  • The result is impaired CD8+ T cell function, increased apoptosis, and TGFβ1 secretion

  • This creates a positive feedback loop that further stimulates NET formation and immunosuppression

CD8+ T cells expressing TMCO6 exhibit an exhausted phenotype in clinical samples, and blocking NET formation (by inhibiting PAD4) has antitumor effects in wild-type mice but not in TMCO6-/- mice .

What experimental approaches are recommended to study TMCO6 in immune contexts?

For researchers investigating TMCO6's role in immune regulation:

  • Flow cytometry to characterize T cell phenotypes in TMCO6-expressing versus TMCO6-deficient conditions

  • Co-culture experiments with neutrophils and T cells to study NET-TMCO6 interactions

  • Chromatin immunoprecipitation (ChIP) assays to analyze NFκB signaling

  • In vivo tumor models comparing wild-type and TMCO6-knockout conditions

  • Combinatorial approaches with immune checkpoint inhibitors (e.g., anti-PD-1) and TGFβ1 signaling inhibitors

How does TMCO6 form oligomers and what techniques can be used to study this process?

While specific information about TMCO6 oligomerization is limited, insights can be drawn from studies of related proteins like TMCC3. The coiled-coil domains likely mediate protein-protein interactions and oligomerization, similar to how TMCC3 forms trimers through its second coiled-coil region .

Recommended techniques to study TMCO6 oligomerization:

  • Size exclusion chromatography

  • Blue native PAGE

  • Chemical cross-linking followed by SDS-PAGE

  • FRET (Förster Resonance Energy Transfer) between differently labeled TMCO6 molecules

  • Analytical ultracentrifugation

Creation of deletion mutants lacking specific coiled-coil domains (similar to the TMCC3-Δ1 and TMCC3-Δ2 approaches) can help determine which domains are essential for oligomerization .

What are the known protein interaction partners of TMCO6 and how can new interactions be identified?

Based on two-hybrid experimental evidence, UBQLN1 (ubiquilin 1) has been identified as a potential interaction partner of TMCO6 . To identify additional interaction partners:

  • Affinity purification coupled with mass spectrometry (AP-MS)

  • Yeast two-hybrid screening

  • Proximity-dependent biotin identification (BioID)

  • Co-immunoprecipitation followed by mass spectrometry

  • Protein microarray screening

Given TMCO6's role in immune regulation, particular attention should be paid to potential interactions with components of T cell receptor signaling pathways and NFκB signaling.

What are the optimal approaches for generating and validating TMCO6 knockout models?

For researchers creating TMCO6 knockout models:

  • CRISPR-Cas9 genome editing:

    • Design gRNAs targeting early exons to ensure complete loss of function

    • Screen for indels using T7 endonuclease assay or Sanger sequencing

    • Verify knockout at protein level by Western blot

    • Confirm phenotypes with multiple independent clones

  • Conditional knockout strategies:

    • Consider Cre-loxP systems for tissue-specific or inducible deletion

    • Particularly valuable for studying liver-specific functions

    • Essential if complete knockout proves embryonically lethal

  • Validation methods:

    • Quantitative PCR for mRNA levels

    • Western blotting for protein expression

    • Functional assays relevant to TMCO6's roles in nuclear transport and T cell function

What considerations are important when designing recombinant TMCO6 constructs for functional studies?

When designing recombinant TMCO6 constructs:

  • Preserve key domains:

    • Both transmembrane domains are required for proper localization

    • Coiled-coil domains are essential for protein-protein interactions

    • The N-terminus is critical for interaction with NET-DNA in immune contexts

  • Selection of expression vectors:

    • Viral vectors (adenovirus, lentivirus) for efficient delivery to diverse cell types

    • Inducible expression systems to control expression levels

  • Tag placement considerations:

    • C-terminal tags are generally preferred to avoid interfering with N-terminal functional domains

    • Flexible linkers should be included between the protein and tag

    • Verify that tags do not disrupt membrane topology or protein interactions

How can TMCO6 be targeted therapeutically in the context of hepatocellular carcinoma?

Based on the role of TMCO6 in mediating CD8+ T cell dysfunction in HCC, several therapeutic strategies emerge:

  • Targeting the NET-TMCO6 interaction:

    • Develop peptides or small molecules that prevent NET-DNA binding to TMCO6

    • Target PAD4 to inhibit NET formation (shown to be effective in wild-type but not TMCO6-/- mice)

  • Combination therapies:

    • TGFβ1 signaling inhibition combined with anti-PD-1 therapy has shown promise in abolishing NET-driven HCC progression in vivo

    • This approach addresses both the immunosuppressive mechanism and immune checkpoint inhibition

  • Delivery strategies:

    • Consider liver-targeted delivery systems for therapeutic agents

    • Nanoparticle formulations for improved pharmacokinetics

    • T cell-directed therapies to specifically modulate TMCO6 function in CD8+ T cells

What methodologies are appropriate for studying TMCO6 variants in mitochondrial disease patients?

For researchers investigating TMCO6's role in mitochondrial disease:

  • Patient sample analysis:

    • Whole exome/genome sequencing to identify TMCO6 variants

    • RNA sequencing to detect aberrant splicing or expression levels

    • Protein analysis from patient-derived cells

  • Functional characterization:

    • Mitochondrial respiration assays (Seahorse XF analysis)

    • Blue native PAGE for respiratory chain complex assembly

    • Complementation studies with wild-type TMCO6 in patient cells

    • Assessment of mitochondrial morphology and distribution

  • Model systems:

    • Patient-derived fibroblasts or induced pluripotent stem cells (iPSCs)

    • CRISPR knock-in of patient-specific mutations in cell lines

    • Conditional knockout animal models for in vivo studies

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.