Recombinant Human Transmembrane and coiled-coil domains protein 2 (TMCC2)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human Transmembrane and Coiled-Coil Domains Protein 2 (TMCC2)

Recombinant Human Transmembrane and Coiled-Coil Domains Protein 2 (TMCC2) is a full-length (1–709 amino acids) human protein expressed in Escherichia coli with an N-terminal His tag for purification and detection . It is primarily studied for its role in Alzheimer’s disease (AD) pathology and erythropoiesis. TMCC2 interacts with amyloid precursor protein (APP) and apolipoprotein E (apoE), two proteins central to AD etiology, and influences β-amyloid (Aβ) secretion .

Alzheimer’s Disease

TMCC2 associates with dense-core senile plaques and dystrophic neurites in AD brains, particularly in late-onset and early-onset cases (e.g., APP mutations or Down syndrome) . Key findings include:

  • Interaction with APP and apoE: TMCC2 forms complexes with APP and apoE, modulating Aβ production. The apoE4 isoform enhances Aβ secretion more than apoE3 in the presence of TMCC2 .

  • Isoform Variability: Human brain-derived TMCC2 exists as three isoforms, with regional and APOE genotype-dependent variations. In Down syndrome AD, TMCC2 localizes to fibrous plaques distinct from classical amyloid deposits .

  • Evolutionary Conserved Role: Drosophila orthologue Dementin protects against APP-induced neurodegeneration, suggesting conserved mechanisms in AD pathogenesis .

Erythropoiesis

Knockout studies in mice reveal TMCC2’s critical role in red blood cell maturation:

  • Defects in Enucleation: TMCC2-deficient mice exhibit cytoplasmic intrusions into nuclei and impaired enucleation, resembling congenital dyserythropoietic anemia .

  • Extramedullary Erythropoiesis: Spleen involvement compensates for bone marrow dysfunction, indicating a systemic impact on erythroid development .

Experimental Tools

ApplicationDetails
SDS-PAGEValidation of protein integrity and purity (>90% purity confirmed) .
Western BlottingDetection using polyclonal antibodies (e.g., PA5-53135 targeting residues 521–600) .
Protein-Protein Interaction StudiesCo-IP and fluorescence assays to study TMCC2-APP/apoE complexes .

Handling and Reconstitution

  • Reconstitution: Lyophilized TMCC2 should be dissolved in deionized water (0.1–1.0 mg/mL). Addition of 50% glycerol (v/v) is recommended for long-term storage .

  • Avoid Repeated Freeze-Thaw: Working aliquots stored at 4°C for ≤1 week .

Alzheimer’s Disease

  • Pathological Localization: TMCC2 immunoreactivity overlaps with APP in control and AD brains but avoids diffuse plaques or neurofibrillary tangles .

  • ApoE Genotype Influence: APOE ε4 carriers show enhanced TMCC2-APP interactions, linking TMCC2 to genetic risk factors .

Erythropoiesis

  • Morphological Defects: TMCC2 knockout mice display double-membrane structures in nucleated red blood cells (nRBCs) and delayed transition from polychromatic to orthochromatic stages .

  • Potential Therapeutic Target: Dysregulation of TMCC2 may contribute to congenital anemias, warranting further investigation .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
TMCC2; KIAA0481; hucep-11; Transmembrane and coiled-coil domains protein 2; Cerebral protein 11
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-709
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
TMCC2
Target Protein Sequence
MKRCRSDELQQQQGEEDGAGLEDAASHLPGADLRPGETTGANSAGGPTSDAGAAAAPNPG PRSKPPDLKKIQQLSEGSMFGHGLKHLFHSRRRSREREHQTSQDSQQHQQQQGMSDHDSP DEKERSPEMHRVSYAMSLHDLPARPTAFNRVLQQIRSRPSIKRGASLHSSSGGGSSGSSS RRTKSSSLEPQRGSPHLLRKAPQDSSLAAILHQHQCRPRSSSTTDTALLLADGSNVYLLA EEAEGIGDKVDKGDLVALSLPAGHGDTDGPISLDVPDGAPDPQRTKAAIDHLHQKILKIT EQIKIEQEARDDNVAEYLKLANNADKQQVSRIKQVFEKKNQKSAQTIAQLHKKLEHYRRR LKEIEQNGPSRQPKDVLRDMQQGLKDVGANVRAGISGFGGGVVEGVKGSLSGLSQATHTA VVSKPREFASLIRNKFGSADNIAHLKDPLEDGPPEEAARALSGSATLVSSPKYGSDDECS SASASSAGAGSNSGAGPGGALGSPKSNALYGAPGNLDALLEELREIKEGQSHLEDSMEDL KTQLQRDYTYMTQCLQEERYRYERLEEQLNDLTELHQNEMTNLKQELASMEEKVAYQSYE RARDIQEAVESCLTRVTKLELQQQQQQVVQLEGVENANARALLGKFINVILALMAVLLVF VSTIANFITPLMKTRLRITSTTLLVLVLFLLWKHWDSLTYLLEHVLLPS
Uniprot No.

Target Background

Function
May be involved in regulating the proteolytic processing of amyloid precursor protein (APP), potentially also influencing apolipoprotein E (APOE).
Database Links

HGNC: 24239

KEGG: hsa:9911

STRING: 9606.ENSP00000350718

UniGene: Hs.6360

Protein Families
TEX28 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is TMCC2 and what is its functional significance in neuronal cells?

TMCC2 (Transmembrane and Coiled-Coil domains protein 2) is a protein that forms complexes with both apolipoprotein E (apoE) and amyloid protein precursor (APP), two proteins central to Alzheimer's disease etiology . In normal cellular function, TMCC2 appears to play roles in brain development, neuronal synapse homeostasis, and within endomembrane systems .

Methodologically, investigations of TMCC2 function involve:

  • Co-immunoprecipitation assays to confirm binding partners

  • Immunohistochemistry to visualize cellular localization

  • Comparative genomics to establish evolutionary conservation

  • Functional assays in cellular and animal models

The evolutionarily conserved interaction between TMCC2 and APP indicates overlapping physiological functions, as demonstrated by studies of its Drosophila orthologue Dementin, which protects against ectopic expression of human APP in vivo .

How is TMCC2 expressed in the human brain?

TMCC2 immunoreactivity in the human brain is primarily neuronal with a somatodendritic pattern, consistent with its proposed roles in endomembrane systems . Western blot analysis of human brain homogenates reveals TMCC2 exists as at least three protein isoforms migrating at positions close to the predicted 77.5 kDa .

To effectively study TMCC2 expression:

  • Use validated antibodies (e.g., antibody 94) previously confirmed against mouse and rat brain-derived TMCC2

  • Perform double immunofluorescence with APP antibodies (e.g., C1/6.1) to examine co-localization

  • Compare expression across multiple brain regions including temporal cortex and cerebellum

  • Stratify samples by APOE genotype to detect potential differences

Staining patterns for TMCC2 show a high degree of similarity with APP, with TMCC2 immunoreactivity rarely being distinct from APP, while APP staining can exist either together with or separate from TMCC2, suggesting a dynamic association .

What is the relationship between TMCC2 and amyloid processing?

TMCC2 demonstrates significant interactions with amyloid processing through several mechanisms:

  • Complex formation with APP: A large fraction of TMCC2 exists in a complex with APP in rat brain, with similar patterns observed in human tissue .

  • Modulation of Aβ secretion: In the presence of apoE, TMCC2 mediates increased Aβ secretion from cells expressing autosomal dominant mutated APP (APPswedish) and from C-terminal fragments generated by BACE cleavage .

  • ApoE isoform-dependent effects: The AD-associated apoE4 isoform shows a larger effect on Aβ production than apoE3 in the presence of TMCC2 .

This relationship can be studied experimentally through:

  • Transfection studies with TMCC2 and APP constructs

  • ELISA assays to measure Aβ production under different conditions

  • Co-localization studies in brain tissue using specific antibodies

  • Functional studies in TMCC2 knockdown/overexpression models

The conserved nature of this interaction across species supports its biological significance in amyloid processing pathways .

How does TMCC2 distribution differ between normal and Alzheimer's disease brains?

In cognitively healthy brains, TMCC2 shows primarily neuronal somatodendritic distribution with close association to APP immunoreactivity . In Alzheimer's disease brains, significant alterations in TMCC2 distribution are observed:

Brain TypeTMCC2 Distribution PatternAPP AssociationPlaque Association
NormalNeuronal somatodendriticClose co-localizationNot applicable
Late-onset ADShrunken neurons, dense core plaquesMaintained in neurons, co-localized in plaquesDense core centers only
Familial ADDense core plaques, some APP+ neurites lack TMCC2Partial dissociationDense core centers only
Down syndrome ADDense core plaques, unique TMCC2+/APP- threadlike structuresComplex patternDense cores and unique structures

Methodologically, these differences are best observed using:

  • Double immunofluorescence for TMCC2 and APP

  • Additional staining with amyloid-specific dyes (e.g., methoxy-X04)

  • Comparative analysis across different AD subtypes and controls

  • Quantitative assessment of co-localization patterns

TMCC2 associates specifically with dense core senile plaques and adjacent dystrophic neurites, but not with diffuse amyloid surrounding the core, diffuse plaques, or neurofibrillary tangles .

What evolutionary insights does TMCC2 provide for Alzheimer's disease research?

The evolutionary conservation of TMCC2 offers significant insights for AD research:

  • The Drosophila orthologue Dementin is highly similar to TMCC2 in amino acid sequence .

  • When mutated, Dementin perturbs metabolism of the Drosophila APP-Like protein, causing neurodegeneration with AD-like features including:

    • Accumulation of APP-Like protein fragments

    • Synaptic defects

    • Early death

  • Dementin protects against ectopic expression of human APP in vivo, demonstrating functional conservation .

Research methodologies leveraging this evolutionary conservation include:

  • Cross-species comparative genomics

  • Transgenic Drosophila models expressing human TMCC2 or APP

  • Structure-function analyses identifying conserved domains

  • Genetic rescue experiments across species

This evolutionary perspective allows researchers to utilize simpler model organisms to understand fundamental mechanisms of TMCC2 function that may be relevant to human AD pathogenesis .

How do TMCC2 isoforms correlate with brain region specificity and APOE genotype?

Western blot analysis reveals that TMCC2 exists as at least three protein isoforms with distinct distribution patterns influenced by both brain region and APOE genotype . Quantitative analysis shows:

ParameterCerebellumTemporal GyrusStatistical Significance
Lower migrating forms57.5 ± 2.7%42.5 ± 3%p=0.002 (two-tailed Student's T-test)
APOE3 homozygotesSignificant regional differenceSignificant regional differenceStatistically significant
APOE4 homozygotesLess pronounced regional differenceLess pronounced regional differenceNot statistically significant

To investigate these differences, researchers should:

  • Perform western blot analysis with gradient gels to maximize isoform separation

  • Use densitometric quantification with appropriate controls

  • Stratify samples by both brain region and APOE genotype

  • Consider potential post-translational modifications using specialized techniques:

    • Phosphatase treatments to detect phosphorylation

    • Glycosidase treatments to detect glycosylation

    • Mass spectrometry to identify specific modifications

This isoform distribution pattern suggests that levels of putative post-translational modification of TMCC2 may be influenced by differential conversion rates between isoforms in APOE3 versus APOE4 backgrounds, or altered in dementia states .

What experimental approaches are most effective for characterizing TMCC2-APP interactions?

Comprehensive characterization of TMCC2-APP interactions requires multiple complementary approaches:

  • Biochemical characterization:

    • Co-immunoprecipitation using antibodies against either protein

    • Proximity ligation assays to confirm in situ interactions

    • FRET/BRET analysis for live cell interaction studies

    • Cross-linking mass spectrometry to identify interaction domains

  • Cellular visualization:

    • Double immunofluorescence with antibody 94 (TMCC2) and C1/6.1 (APP C-terminus)

    • Super-resolution microscopy for subcellular localization

    • Live-cell imaging with fluorescently tagged constructs

    • Electron microscopy for ultrastructural analysis

  • Functional analysis:

    • CRISPR-Cas9 modification of TMCC2 in neuronal models

    • Domain mapping through deletion/mutation constructs

    • Amyloid production assays (ELISA) following manipulation

    • Trafficking studies using pulse-chase approaches

  • Disease-relevant contexts:

    • iPSC-derived neurons from patients with different APOE genotypes

    • Brain organoids modeling developmental aspects

    • Analysis in post-mortem tissue from varied AD subtypes

    • Animal models with humanized APOE alleles

These approaches have revealed that TMCC2 and APP show highly similar distribution patterns in human brain, with TMCC2 immunoreactivity rarely distinct from APP, while APP can exist separately from TMCC2, suggesting a dynamic complex formation .

How does TMCC2 pathology differ across Alzheimer's disease subtypes?

TMCC2 demonstrates distinctive pathological features across different AD subtypes:

AD SubtypeTMCC2 in Dense Core PlaquesTMCC2 in Dystrophic NeuritesUnique Features
LOAD (APOE3)Present in core centerPresentNone distinctive
LOAD (APOE4)Present in core centerPresentNone distinctive
Familial AD (APP V717)Present in core centerPresentAPP+/TMCC2- dystrophic neurites
Down Syndrome ADPresent in core centerPresentTMCC2+/methoxy-X04+/APP- spicular structures

Methodological approaches to distinguish these differences:

  • Triple labeling with TMCC2, APP, and amyloid markers

  • Quantitative morphometric analysis of pathological structures

  • Case stratification by genetic background and disease stage

  • Serial section analysis to track pathology in three dimensions

The unique TMCC2+/APP- pathology in Down syndrome may be related to chromosome 21 gene overexpression beyond APP, as mouse models of trisomy 21 and iPSC-derived Down syndrome neurons show that other chromosome 21 genes exacerbate AD pathogenesis .

What methods can detect post-translational modifications of TMCC2 in clinical samples?

Detecting post-translational modifications (PTMs) of TMCC2 in clinical samples requires specialized methodologies:

  • Sample preparation optimization:

    • Rapid post-mortem tissue collection (<12 hours)

    • Preservation of modification-specific buffers (phosphatase/protease inhibitors)

    • Subcellular fractionation to enrich for membrane-associated TMCC2

    • Gentle solubilization protocols to maintain protein complexes

  • Modification-specific detection methods:

    • Phosphorylation: Phos-tag gels followed by western blotting

    • Glycosylation: Lectin affinity purification and glycosidase treatments

    • Ubiquitination: Immunoprecipitation under denaturing conditions

    • SUMOylation: SUMO-trap pulldown followed by TMCC2 detection

  • Advanced analytical techniques:

    • Mass spectrometry with enrichment for specific modifications

    • Targeted MS/MS for known modification sites

    • Middle-down proteomics for larger fragments

    • Top-down proteomics for intact protein analysis

  • Validation approaches:

    • Site-directed mutagenesis of potential modification sites

    • Modification-specific antibodies when available

    • Correlation with functional outcomes in cellular models

    • Comparison across brain regions and disease states

The western blot analysis of TMCC2 reveals at least three distinct bands, suggesting multiple isoforms potentially arising from PTMs . The differential abundance of these isoforms between cerebellum and temporal gyrus, and their association with APOE genotype, indicates physiologically and pathologically relevant modifications .

How can we design experiments to elucidate TMCC2's role in Down syndrome-associated Alzheimer's disease?

The unique TMCC2 pathology in Down syndrome AD requires specialized experimental designs:

  • Comparative tissue analysis:

    • Expanded cohort of Down syndrome cases across age ranges

    • Matched controls with late-onset and familial AD

    • Quantitative assessment of TMCC2+/APP-/methoxy-X04+ structures

    • Electron microscopy characterization of unique structures

  • Cellular modeling:

    • iPSC-derived neurons from Down syndrome individuals

    • CRISPR-Cas9 correction of trisomy in isogenic lines

    • Overexpression of chromosome 21 genes individually and in combination

    • Time-course analysis of TMCC2 expression and localization

  • Animal models:

    • Ts65Dn or other mouse models of trisomy 21

    • Crossing with APP transgenic models

    • TMCC2 knockout or overexpression in these backgrounds

    • Longitudinal assessment of pathology development

  • Molecular characterization:

    • Biochemical isolation of TMCC2+ structures from Down syndrome tissue

    • Proteomic analysis of associated proteins

    • RNA-seq of regions with pathology to identify altered pathways

    • Chromatin analysis to identify epigenetic influences

  • Therapeutic testing platform:

    • High-content screening for modulators of TMCC2 processing/localization

    • Drug repurposing focused on TMCC2 pathways

    • Gene therapy approaches targeting TMCC2

    • Antibody-based therapies to target pathological forms

Data from Down syndrome AD cases reveals that dystrophic neurites in senile plaques can be positive for amyloid and TMCC2 but negative for APP, unlike other AD forms . Additionally, unique spicular or threadlike TMCC2+ structures suggest a distinct pathological process that may involve chromosome 21 genes beyond APP .

What is the optimal protocol for immunohistochemical detection of TMCC2 in brain tissue?

The optimal protocol for TMCC2 immunohistochemistry involves several critical steps:

  • Tissue preparation:

    • Fixation: 4% paraformaldehyde, 24-48 hours

    • Processing: Careful dehydration to maintain antigenicity

    • Sectioning: 5-10 μm thickness optimal for co-localization studies

    • Antigen retrieval: Citrate buffer pH 6.0, 95°C for 20 minutes

  • Antibody selection and validation:

    • Primary antibody: Rabbit antibody 94 shows superior specificity compared to antibody 11193

    • Validation: Confirm specificity using western blot of brain homogenates

    • Concentration: Optimize through titration (typically 1:100-1:500)

    • Controls: Include TMCC2-depleted tissue or blocking peptide controls

  • Detection system:

    • For fluorescence: Use high-sensitivity fluorophores with minimal spectral overlap

    • For chromogenic detection: Peroxidase-based systems provide good sensitivity

    • Counterstaining: Nuclear counterstain helps cellular identification

    • Mounting: Anti-fade mounting media for fluorescence preservation

  • Co-localization studies:

    • Double-label with APP antibody C1/6.1 (binding C-terminus, residues 676-695)

    • Triple-label with methoxy-X04 for amyloid detection

    • Sequential antibody application to prevent cross-reactivity

    • Careful washing between steps to minimize background

This methodology has successfully demonstrated TMCC2's neuronal somatodendritic pattern and its association with dense core senile plaques, while confirming it does not associate with diffuse amyloid or neurofibrillary tangles .

What technical considerations are important when analyzing TMCC2 isoforms by western blotting?

Western blot analysis of TMCC2 isoforms requires specific technical considerations:

  • Sample preparation:

    • Tissue homogenization: Use mild detergents (e.g., CHAPS or NP-40)

    • Protein extraction: Include protease and phosphatase inhibitors

    • Storage: Minimize freeze-thaw cycles to preserve modifications

    • Loading amount: 20-50 μg protein per lane typically optimal

  • Gel electrophoresis parameters:

    • Gel percentage: 8-10% acrylamide gels provide optimal separation

    • Running conditions: Lower voltage (80-100V) improves isoform resolution

    • Gradient gels: Consider for enhanced separation of closely migrating forms

    • Size markers: Include appropriate molecular weight standards (50-100 kDa range)

  • Transfer and detection optimization:

    • Transfer method: Semi-dry transfer sufficient for TMCC2 size range

    • Membrane selection: PVDF membranes preferred for multiple probing

    • Blocking agent: 5% non-fat milk in TBS-T (1 hour at room temperature)

    • Primary antibody: Antibody 94 shows superior specificity for TMCC2

  • Quantitative analysis:

    • Image acquisition: Use linear dynamic range settings

    • Normalization: Housekeeping proteins appropriate for brain region

    • Densitometry: Analyze each band separately using consistent boundaries

    • Statistical analysis: Account for biological and technical replicates

This approach successfully detected three TMCC2 isoforms in human brain homogenates, migrating at positions close to that predicted from amino acid composition (77.5 kDa) . The isoforms showed differential distribution between temporal gyrus and cerebellum, potentially influenced by APOE genotype .

How can researchers effectively model TMCC2 function in cellular and animal systems?

Effective modeling of TMCC2 function requires multi-level experimental systems:

  • Cell-based models:

    • Primary neuronal cultures: Closest to in vivo biology

    • Neuroblastoma cell lines: Easier manipulation, moderate relevance

    • HEK293 or similar: Good for biochemical studies, lower relevance

    • iPSC-derived neurons: Capture human genetic background

    Key approaches:

    • Overexpression studies with tagged constructs

    • CRISPR-Cas9 knockout or knockin

    • siRNA/shRNA knockdown

    • Domain mutation analysis

  • Drosophila models:

    • Leverage evolutionary conservation with Dementin

    • GAL4-UAS system for tissue-specific expression

    • Available APP-Like protein mutants

    • Rapid generation time for genetic screens

    Key phenotypes:

    • Neurodegeneration patterns

    • APP-Like protein processing

    • Lifespan and behavior assays

    • Synaptic structure and function

  • Mouse models:

    • TMCC2 knockout or conditional knockout

    • Human TMCC2 knockin

    • Crosses with AD models (APP, tau, APOE)

    • Age-dependent phenotyping

    Key assessments:

    • Biochemical analysis of APP processing

    • Histopathological examination

    • Behavioral testing

    • Electrophysiology for synaptic function

  • Integration with human data:

    • Compare findings with human post-mortem observations

    • Validate in iPSC-derived neurons from AD patients

    • Consider APOE genotype influences

    • Correlate with clinical/neuropathological parameters

Studies in Drosophila have demonstrated that mutation of Dementin causes neurodegeneration with AD-like features, providing a validated model system . This cross-species approach allows researchers to capitalize on the evolutionarily conserved nature of TMCC2-APP interactions .

What bioinformatic approaches best predict TMCC2 structure-function relationships?

Understanding TMCC2 structure-function relationships requires integrated bioinformatic approaches:

  • Sequence analysis:

    • Multiple sequence alignment across species to identify conserved domains

    • Identification of the transmembrane and coiled-coil domains

    • Prediction of post-translational modification sites

    • Analysis of alternative splicing patterns

    Tools:

    • MUSCLE/Clustal for alignments

    • TMHMM for transmembrane domains

    • COILS for coiled-coil regions

    • NetPhos for phosphorylation sites

  • Structural prediction:

    • Ab initio modeling of domains

    • Homology modeling where templates exist

    • Molecular dynamics simulations

    • Protein-protein docking with APP and apoE

    Tools:

    • AlphaFold2 for tertiary structure

    • I-TASSER for domain modeling

    • HADDOCK for protein-protein interactions

    • GROMACS for molecular dynamics

  • Functional inference:

    • Gene ontology enrichment analysis

    • Pathway analysis of interacting partners

    • Co-expression network analysis

    • Evolutionary rate analysis of protein domains

    Tools:

    • STRING for protein interaction networks

    • DAVID/PANTHER for functional annotation

    • Cytoscape for network visualization

    • PAML for evolutionary rate calculation

  • Integration with experimental data:

    • Map antibody epitopes to structural models

    • Correlate mutations/variants with structural features

    • Identify critical residues for APP/apoE binding

    • Guide experimental design for mutation studies

This approach can help understand how TMCC2 forms complexes with both APP and apoE, potentially mediating apoE's influence on APP processing in an isoform-specific manner . The structure-function analysis can also explain how certain regions might be involved in the differential effects of apoE3 versus apoE4 on Aβ production in the presence of TMCC2 .

How can mass spectrometry be optimized for characterization of TMCC2 in complex brain samples?

Mass spectrometry approaches for TMCC2 require specialized optimization for brain tissue analysis:

  • Sample preparation strategies:

    • Subcellular fractionation to enrich membrane-associated TMCC2

    • Immunoprecipitation to isolate TMCC2 and complexes

    • Filter-aided sample preparation (FASP) for detergent compatibility

    • Sequential extraction to analyze different TMCC2 pools

  • MS analysis parameters:

    • Data-dependent acquisition for discovery proteomics

    • Parallel reaction monitoring for targeted quantification

    • Crosslinking MS for interaction interfaces

    • Native MS for intact complex analysis

    Key settings:

    • Higher-energy collisional dissociation (HCD) for peptide fragmentation

    • Extended gradient separation for complex samples

    • MS3 for phosphopeptide analysis

    • Ion mobility separation for additional dimension

  • Post-translational modification analysis:

    • Enrichment strategies for phosphopeptides (TiO2, IMAC)

    • Glycopeptide analysis with specialized fragmentation

    • Multi-protease digestion for improved sequence coverage

    • Label-free quantification of modification stoichiometry

  • Data analysis workflow:

    • Database search against human proteome plus variants

    • De novo sequencing for novel peptides/modifications

    • Quantitative comparison across brain regions

    • Integration with TMCC2 isoform data from western blots

    Software tools:

    • MaxQuant/Andromeda for peptide identification

    • Skyline for targeted quantification

    • PTM-Shepherd for modification analysis

    • Perseus for statistical evaluation

This approach can potentially identify the nature of the three TMCC2 protein isoforms observed in western blots and characterize region-specific and APOE genotype-dependent post-translational modifications , providing deeper insights into TMCC2's role in AD pathogenesis.

How does TMCC2 research inform potential therapeutic strategies for Alzheimer's disease?

TMCC2 research offers several promising avenues for therapeutic development:

  • TMCC2-APP interaction modulation:

    • Small molecule inhibitors of TMCC2-APP binding

    • Peptide-based disruptors of specific interaction domains

    • Allosteric modulators affecting complex formation

    • Stabilizers of protective TMCC2-APP conformations

  • ApoE isoform-specific approaches:

    • Compounds targeting TMCC2-apoE4 interaction specifically

    • Structural correctors to make apoE4 behave more like apoE3

    • Small molecules enhancing TMCC2-apoE3 protective effects

    • Protein engineering of modified apoE variants

  • TMCC2 post-translational modification targeting:

    • Inhibitors of enzymes modifying TMCC2

    • Stabilizers of specific TMCC2 isoforms

    • Region-specific delivery strategies

    • Temporal modulation during disease progression

  • Genetic and RNA-based therapies:

    • Antisense oligonucleotides for isoform modulation

    • CRISPR-based gene editing of APOE risk alleles

    • mRNA therapeutics to enhance protective TMCC2 forms

    • microRNA modulators of TMCC2 expression

The evolutionarily conserved interaction between TMCC2 and APP family members suggests fundamental biological importance that could be leveraged therapeutically . Additionally, the differential interactions of TMCC2 with apoE3 versus apoE4, and their effects on Aβ production, provide a potential mechanism to address APOE4-associated risk .

What biomarker potential does TMCC2 have for Alzheimer's disease diagnosis or monitoring?

TMCC2 demonstrates several characteristics suggesting biomarker potential:

  • Tissue-based biomarkers:

    • TMCC2 immunoreactivity patterns in post-mortem tissue

    • TMCC2 isoform ratios in different brain regions

    • TMCC2-APP co-localization quantification

    • TMCC2 association with specific plaque morphologies

  • Fluid biomarker possibilities:

    • Exploration of TMCC2 or fragments in CSF

    • Development of assays for TMCC2-APP or TMCC2-apoE complexes

    • Post-translationally modified TMCC2 in biofluids

    • Exosome-associated TMCC2 in plasma

  • Imaging biomarker development:

    • PET ligands targeting TMCC2-enriched dense core plaques

    • MRI approaches to detect regions with altered TMCC2 expression

    • Multimodal imaging correlating TMCC2 with established AD markers

    • Longitudinal imaging to track TMCC2-related pathology

  • Genetic biomarkers:

    • TMCC2 genetic variants as risk modifiers

    • Gene expression profiles related to TMCC2 pathways

    • Integration with APOE genotyping

    • Polygenic risk scores incorporating TMCC2-related genetics

The association of TMCC2 with dense core senile plaques across different AD subtypes provides a specific pathological signature . The unique TMCC2+/APP- structures in Down syndrome AD could serve as specific markers for this subtype . Additionally, the influence of APOE genotype on TMCC2 isoform distribution suggests potential for integrated biomarker approaches combining protein isoform analysis with genetic risk assessment .

How should experimental design account for APOE genotype when studying TMCC2?

APOE genotype significantly influences TMCC2 biology, requiring careful experimental design:

  • Sample stratification guidelines:

    • Always determine APOE genotype for all human samples

    • Match cases and controls by genotype when possible

    • Analyze APOE3/3, APOE3/4, and APOE4/4 separately

    • Include sufficient statistical power for stratified analysis

  • Cellular model recommendations:

    • Use isogenic iPSC lines with APOE edited to different variants

    • Include all three common alleles (ε2, ε3, ε4) when possible

    • Control for APOE expression levels across models

    • Assess both secreted and cell-associated apoE

  • Animal model considerations:

    • Use human APOE knockin mouse models

    • Include all relevant genotypes in experimental design

    • Age-match carefully as effects may be time-dependent

    • Consider brain region-specific analyses based on human data

  • Statistical analysis approaches:

    • Test for APOE-TMCC2 interactions in all models

    • Perform subgroup analyses when sample size permits

    • Use appropriate multiple testing corrections

    • Consider Bayesian approaches for small sample sizes

Research has demonstrated that TMCC2 isoform distribution patterns between brain regions were statistically significant in APOE3 homozygotes but not in APOE4 homozygotes, highlighting the importance of genotype stratification . Additionally, apoE4 shows a larger effect on Aβ production than apoE3 in the presence of TMCC2, suggesting mechanistic differences requiring genotype-specific analysis .

How can TMCC2 research inform understanding of differential vulnerability in Alzheimer's disease?

TMCC2 research provides insights into differential vulnerability patterns in AD:

  • Brain region vulnerability:

    • TMCC2 isoforms show differential distribution between temporal gyrus and cerebellum

    • This correlates with known pattern of selective vulnerability in AD

    • May relate to region-specific co-factors or modifiers

    • Could explain resistance of cerebellum to AD pathology

  • Genetic background effects:

    • APOE genotype influences TMCC2 isoform patterns

    • Suggests mechanism for APOE4-related increased vulnerability

    • May interact with other genetic risk factors

    • Potentially explains incomplete penetrance of genetic risk

  • AD subtype differences:

    • Distinct TMCC2 pathology in Down syndrome versus late-onset AD

    • Different patterns in familial versus sporadic disease

    • Suggests multiple pathways to TMCC2 dysfunction

    • May inform personalized treatment approaches

  • Research methodology implications:

    • Compare multiple brain regions within same individuals

    • Analyze trajectory of changes across disease progression

    • Develop computational models of region-specific vulnerability

    • Integrate with other vulnerability factors (connectivity, metabolism)

The finding that TMCC2 exists as at least three protein isoforms with relative abundance varying between temporal gyrus and cerebellum, influenced by both APOE genotype and possibly dementia status, provides a potential mechanism for selective vulnerability . This suggests that TMCC2 modifications may contribute to the differential susceptibility of brain regions to AD pathology.

What are the most promising directions for future TMCC2 research in neurodegeneration?

Future TMCC2 research should focus on these promising directions:

  • Mechanistic understanding:

    • Detailed structural characterization of TMCC2-APP-apoE complexes

    • Mapping of interaction domains and critical residues

    • Elucidation of signaling pathways regulated by TMCC2

    • Identification of enzymes modifying TMCC2 isoforms

  • Disease spectrum investigations:

    • Expand from AD to other neurodegenerative conditions

    • Examine TMCC2 in mixed pathologies (AD+vascular, AD+Lewy body)

    • Explore role in primary age-related tauopathy

    • Investigate in neurodegeneration with brain iron accumulation

  • Therapeutic development:

    • High-throughput screens for TMCC2-APP interaction modulators

    • Structure-based drug design targeting specific domains

    • Development of biologics (antibodies, recombinant proteins)

    • Gene therapy approaches for protective TMCC2 variants

  • Translational biomarkers:

    • Development of PET ligands for TMCC2-associated pathology

    • CSF assays for TMCC2 or fragments

    • Blood-based biomarkers related to TMCC2 pathway

    • Digital biomarkers correlating with TMCC2 pathology

  • Integrative approaches:

    • Multi-omics profiling of TMCC2-related pathways

    • Systems biology modeling of TMCC2 networks

    • AI/machine learning to identify TMCC2 interaction patterns

    • Population-level genetic studies of TMCC2 variants

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.