Recombinant Human Transmembrane and ubiquitin-like domain-containing protein 1 (TMUB1)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Human Transmembrane and Ubiquitin-Like Domain-Containing Protein 1 (TMUB1) is a protein that participates in the endoplasmic reticulum-associated protein degradation (ERAD) pathway and contains a ubiquitin-like domain . Initially reported in 2005, TMUB1 is involved in several cellular processes, including receptor trafficking, regulation of locomotor activity, and tumorigenesis . The TMUB1 protein, which has a total length of 1381 bp, contains 245 amino acids and includes a nuclear export signal (NES) at the amino terminus and a region containing a similar ubiquitin structure (UBL; 121–175 aa) .

Gene and Protein Structure

The TMUB1 gene is located at the 4q11 position on chromosome 4 in rats (located on chromosome 7 in humans) . The protein includes a nuclear export signal (NES) at the amino terminus and a region containing a similar ubiquitin structure (UBL; 121–175 aa) . TMUB1 is a transmembrane protein and functions as a nuclear-cytoplasmic shuttle protein. It is released from the membrane and shuttles between the cytoplasm and the nucleus to exert its biological functions .

Function

TMUB1 participates in the ERAD pathway as a ubiquitin-like protein . It is involved in the recognition and ubiquitination of misfolded proteins, facilitating their disposal by the proteasome .

TMUB1 plays a role in regulating basal synaptic transmission and facilitates the recycling of the AMPAR subunit GluR2 to the cell surface . Neurons transfected with TMUB1/HOPS-RNAi plasmids show a significant reduction in the AMPAR current compared to their control neurons. Consistently, the synaptic surface expression of GluR2, but not of GluR1, is significantly decreased in the neurons transfected with the TMUB1/HOPS-RNAi and increased in the neurons overexpressing EGFP-TMUB1/HOPS .

Research indicates that TMUB1 influences locomotor activity and wakefulness . Studies involving mice with TMUB1 deleted showed a strong increase in home cage locomotor activity during the dark phase of the light/dark cycle. EEG analysis revealed increased waking and decreased NREM & REM times during the dark phase in these knockout mice .

Role in Cancer

Studies suggest that TMUB1 is associated with the prognosis of colon cancer, with high expression of TMUB1 being a negative prognostic factor . TMUB1 may be a potential target for colon cancer . The relationship between TMUB1 expression and clinical features was analyzed using univariate logistic regression .

TMUB1 protein levels correlate with PD-L1 expression in human tumor tissue, with high expression being associated with poor patient survival .

TMUB1 and STAT Signaling

TMUB1 can inhibit STAT3 function by suppressing the phosphorylation of STAT3 . STAT1 and STAT3 have antagonistic effects in promoting tumorigenesis and proliferation. High STAT1 expression indicates a better prognosis for HCC patients . STAT1 expression and TMUB1 expression are positively correlated .

Clinical Significance

The correlation between TMUB1 expression and clinicopathological features has been analyzed, showing its involvement in cancer prognosis and progression .

Table 1: Correlation between TMUB1 expression and clinicopathological features

CharacteristicsTotal (N)Odds ratio (OR)P value
T stage (T3&T4 vs. T1&T2)4770.953 (0.606–1.498)0.836
N stage (N1&N2 vs. N0)4781.368 (0.949–1.975)0.094
M stage (M1 vs. M0)4152.082 (1.210–3.675)0.009
Pathologic stage (Stage III&Stage IV vs. Stage I&Stage II)4671.487 (1.029–2.153)0.035
Perineural invasion (YES vs. NO)1810.966 (0.476–1.916)0.921
Lymphatic invasion (YES vs. NO)4341.961 (1.327–2.911)<0.001

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline for your own protocols.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
TMUB1; C7orf21; DULP; HOPS; SB144; UNQ763/PRO1555; Transmembrane and ubiquitin-like domain-containing protein 1; Dendritic cell-derived ubiquitin-like protein; Hepatocyte odd protein shuttling protein; Ubiquitin-like protein SB144
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-246
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
TMUB1
Target Protein Sequence
MTLIEGVGDEVTVLFSVLACLLVLALAWVSTHTAEGGDPLPQPSGTPTPSQPSAAMAATD SMRGEAPGAETPSLRHRGQAAQPEPSTGFTATPPAPDSPQEPLVLRLKFLNDSEQVARAW PHDTIGSLKRTQFPGREQQVRLIYQGQLLGDDTQTLGSLHLPPNCVLHCHVSTRVGPPNP PCPPGSEPGPSGLEIGSLLLPLLLLLLLLLWYCQIQYRPFFPLTATLGLAGFTLLLSLLA FAMYRP
Uniprot No.

Target Background

Function

TMUB1 is involved in several key cellular processes. It plays a role in sterol-regulated ubiquitination and degradation of HMG-CoA reductase (HMGCR), and positively regulates the recycling of AMPA-selective glutamate receptor GRIA2 to the cell surface. Further, it acts as a negative regulator of hepatocyte growth during liver regeneration. TMUB1 may also contribute to the regulation of translation during cell-cycle progression, and the regulation of cell proliferation. Evidence suggests a role in centrosome assembly. Finally, TMUB1 modulates the stabilization and nucleolar localization of the tumor suppressor CDKN2A, enhancing its association with NPM1.

Gene References Into Functions
  1. A novel ubiquitin-like molecule, DULP, was identified in human dendritic cells. PMID: 19254477
Database Links

HGNC: 21709

OMIM: 614792

KEGG: hsa:83590

STRING: 9606.ENSP00000297533

UniGene: Hs.726215

Subcellular Location
Membrane; Multi-pass membrane protein. Cell junction, synapse, postsynaptic cell membrane. Recycling endosome. Cytoplasm. Nucleus. Nucleus, nucleolus.; [iHOPS]: Cytoplasm. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Nucleus, nucleolus. Nucleus.
Tissue Specificity
Ubiquitously expressed with highest levels in mammary and thyroid glands, bone marrow and spleen; limited expression in cardiac, pancreatic and ovarian tissues.

Q&A

What is the molecular structure of TMUB1 and how is it organized?

TMUB1 (also known as HOPS - Hepatocyte Odd Protein Shuttling) is a 245-amino acid protein characterized by a nuclear export signal (NES) at the amino-terminal and a ubiquitin-like region (UBL; 121–175 aa) . The protein structure includes three key components:

  • An N-terminal domain containing a transmembrane structural domain

  • A central ubiquitin-like domain

  • A C-terminal region containing two transmembrane structures

TMUB1 is a transmembrane protein that shuttles between the nucleus and cytoplasm, potentially transmitting biological signals through this mechanism . The gene encoding TMUB1 is located on chromosome 7 in humans and at the 4q11 position on chromosome 4 in rats .

How is TMUB1 typically expressed across different tissues and conditions?

TMUB1 is ubiquitously expressed, with significant presence in regenerating liver tissue . Expression analysis has revealed:

  • TMUB1 mRNA levels are increased in 17 cancer groups and 21 different cancer types according to TCGA database analysis

  • There are differential expression patterns in cancerous tissues compared to adjacent normal tissues, though with some contradictions across cancer types

  • Expression levels don't change significantly following LPS treatment, suggesting its regulation occurs primarily at the post-translational level rather than transcriptional level

How does TMUB1 influence cell cycle regulation and proliferation?

TMUB1 functions as a negative regulator of cell proliferation, particularly in hepatocytes. Key experimental findings show:

  • TMUB1 overexpression leads to G0/G1 cell cycle arrest, while knockdown promotes entry into S phase

  • EdU and CCK-8 assays demonstrate that TMUB1 overexpression significantly inhibits cell proliferation rates in BRL-3A cells

  • TMUB1 directly interacts with cyclin A2 throughout multiple cell cycle phases (G1, S, and M), potentially influencing both G1/S transition and M phase progression

Cell Cycle PhaseEffect of TMUB1 OverexpressionEffect of TMUB1 Knockdown
G0/G1Increased proportionDecreased proportion
S PhaseDecreased proportionIncreased proportion
ProliferationInhibitedEnhanced

These effects are mediated through interactions with cell cycle regulatory proteins, particularly cyclins .

What role does TMUB1 play in protein degradation and ubiquitination processes?

As a ubiquitin-like protein, TMUB1 participates in several protein degradation and post-translational modification pathways:

  • TMUB1 is involved in the endoplasmic reticulum-associated protein degradation (ERAD) pathway

  • It mediates ubiquitylation and degradation of HMG-CoA reductase HMGCR by bridging SPFH2 to the membrane-bound ubiquitin ligase gp78 in ER membranes

  • Interestingly, TMUB1 appears to inhibit degradation of cyclin A2 and B1, suggesting context-dependent roles in protein stability regulation

  • It competes with HUWE1 (an E3 ubiquitin ligase) to interact with PD-L1, inhibiting its polyubiquitination at K281 in the endoplasmic reticulum

These findings point to TMUB1 as a multifunctional regulator of protein stability, acting as both a facilitator and inhibitor of protein degradation depending on its binding partners and cellular context.

How does TMUB1 expression correlate with cancer progression and prognosis?

The relationship between TMUB1 and cancer appears complex and potentially cancer-type dependent:

This apparent contradiction between increased expression in some cancers and decreased expression in others suggests tissue-specific functions and regulatory mechanisms.

What experimental evidence demonstrates TMUB1's role in tumor suppression?

Several experimental approaches have demonstrated TMUB1's tumor-suppressive functions:

  • Xenograft models show that TMUB1 overexpression significantly reduces tumor growth in vivo

  • Cell experiments confirm that TMUB1 overexpression suppresses HCC cell proliferation

  • Flow cytometry analysis reveals that TMUB1 can promote cell apoptosis

  • Mechanistically, TMUB1 overexpression arrests the cell cycle in G0/G1 phase, preventing cancer cell proliferation

Furthermore, TMUB1 interacts with nucleophosmin (NPM) and p19 Arf, resulting in proper control of p19 Arf stability and localization, which provides new mechanistic insight into how TMUB1 opposes cell proliferation .

How does TMUB1 influence immune checkpoint molecules and anti-tumor immunity?

TMUB1 has been identified as a critical modulator of PD-L1 post-translational modifications in tumor cells, directly impacting immune evasion mechanisms:

  • TMUB1 competes with HUWE1 (E3 ubiquitin ligase) to interact with PD-L1 and inhibit its polyubiquitination at K281 in the endoplasmic reticulum

  • It enhances PD-L1 N-glycosylation and stability by recruiting STT3A, thereby promoting PD-L1 maturation and tumor immune evasion

  • TMUB1 protein levels correlate with PD-L1 expression in human tumor tissue, with high expression associated with poor patient survival rates

  • A synthetic peptide engineered to compete with TMUB1 significantly promotes antitumor immunity and suppresses tumor growth in mice models

These findings position TMUB1 as a potential immunotherapeutic target in cancer treatment.

What is TMUB1's role in inflammatory signaling pathways?

TMUB1 significantly influences inflammatory responses through the NF-κB signaling pathway:

  • TMUB1 enhances NF-κB activation leading to increased transcription of inflammatory mediators by reducing IκBα stability

  • This effect is mediated by direct TMUB1 binding to the E3 ubiquitin ligase TRAF6, which lessens TRAF6 stability, ultimately leading to increased IKK complex activation

  • Cells from TMUB1 knockout mice (Hops−/−) show reduced expression of pro-inflammatory genes including Il-6, Il-1β, and Tnfα after LPS stimulation

  • TMUB1 specifically enhances p65-mediated transcriptional activity, leading to increased expression of pro-inflammatory cytokines, chemokines, and adhesion molecules

Interestingly, TMUB1 appears to selectively influence inflammatory NF-κB target genes without affecting anti-apoptotic or pro-apoptotic NF-κB targets, suggesting pathway-specific regulation .

What are the most effective experimental approaches for studying TMUB1 function?

Based on published research, several effective methodologies have been established:

  • Gene Manipulation Techniques:

    • Lentiviral vectors for stable overexpression or knockdown in cell lines

    • CRISPR/Cas9 for generating knockout models (Hops−/− mice)

  • Protein Interaction Studies:

    • Co-immunoprecipitation (CoIP) to identify binding partners

    • Mass spectrometry (MS) for identifying Tmub1-binding proteins

    • GST pull-down assays for confirming direct protein interactions

  • Functional Assays:

    • EdU and CCK-8 assays for cell proliferation analysis

    • Flow cytometry for cell cycle analysis and apoptosis detection

    • Luciferase reporter assays for studying transcriptional activation

    • Chromatin immunoprecipitation (ChIP) for analyzing histone modifications

  • In Vivo Models:

    • Xenograft tumor models in nude mice

    • Transgenic mouse models (Hops−/− mice)

How can researchers overcome challenges in TMUB1 purification and activity assays?

Purification and activity assessment of TMUB1 presents several challenges due to its transmembrane nature and nuclear-cytoplasmic shuttling properties. Researchers should consider:

  • Protein Extraction:

    • Use specialized cell lysis buffers containing protease inhibitor cocktail and phosphatase inhibitor cocktail

    • For membrane-bound TMUB1, consider detergent-based extraction methods

  • Activity Assessment:

    • Cell cycle synchronization methods using nocodazole (330 nM for 18h) to study phase-specific interactions

    • Time-course experiments following cell cycle release to monitor dynamic interactions

  • Localization Studies:

    • Subcellular fractionation to separate nuclear, cytoplasmic, and membrane fractions

    • Immunofluorescence microscopy to track shuttling between compartments

  • Recombinant Protein Production:

    • Consider expressing domains separately (particularly the ubiquitin-like domain) for functional studies

    • Use mammalian expression systems rather than bacterial systems to ensure proper post-translational modifications

How might TMUB1 be targeted therapeutically in cancer and immune disorders?

Recent research suggests several potential therapeutic approaches:

  • Peptide-Based Interventions:

    • A synthetic peptide engineered to compete with TMUB1 has been shown to promote antitumor immunity and suppress tumor growth in mice models

    • This peptide targets the interaction between TMUB1 and PD-L1, potentially enhancing immune checkpoint blockade therapies

  • Combined Immunotherapy Approaches:

    • TMUB1 inhibition could potentially sensitize tumors to existing PD-1/PD-L1 inhibitors

    • Combination therapies targeting both TMUB1 and other immune checkpoint molecules might overcome resistance mechanisms

  • Anti-Inflammatory Applications:

    • Given TMUB1's role in NF-κB signaling, inhibitors might have applications in inflammatory conditions

    • The TMUB1-TRAF6 interaction represents a potential target for anti-inflammatory drug development

What current controversies or contradictions exist in TMUB1 research?

Several contradictions and open questions remain in TMUB1 research:

  • Cancer-Type Specific Effects:

    • TMUB1 appears upregulated in some cancers but downregulated in others (e.g., higher mRNA levels in 17 cancer groups according to TCGA but lower expression in HCC )

    • This suggests context-dependent functions that require further investigation

  • Dual Roles in Protein Stability:

    • TMUB1 promotes ubiquitylation and degradation of some proteins (HMGCR) while inhibiting degradation of others (cyclin A2, B1, PD-L1)

    • The molecular basis for these opposing functions remains unclear

  • Cell Cycle Regulation:

    • TMUB1 appears to both inhibit cell proliferation and interact with cyclins essential for cell cycle progression

    • The precise mechanisms integrating these seemingly contradictory functions need clarification

  • Therapeutic Potential:

    • Whether TMUB1 inhibition would be beneficial or harmful depends on cancer type and context

    • More research is needed to identify biomarkers predicting response to TMUB1-targeted therapies

What emerging areas of TMUB1 research warrant further investigation?

Several promising research directions emerge from current knowledge:

  • Structural Biology:

    • Detailed structural analysis of TMUB1's domains and their interactions with binding partners

    • Crystal structure determination of TMUB1-PD-L1 and TMUB1-cyclin A2 complexes

  • Systems Biology Approaches:

    • Comprehensive interactome mapping to identify the complete network of TMUB1 interactions

    • Integration of genomic, transcriptomic, and proteomic data to understand context-dependent functions

  • Translational Applications:

    • Development of small-molecule inhibitors targeting specific TMUB1 interactions

    • Biomarker studies to identify patient populations likely to benefit from TMUB1-targeted therapies

  • Regulatory Mechanisms:

    • Investigation of how TMUB1 shuttling between cellular compartments is regulated

    • Identification of post-translational modifications that affect TMUB1 function

  • Tissue-Specific Functions:

    • Comparative studies across different tissues to understand the basis for contradictory expression patterns in different cancers

    • Development of tissue-specific conditional knockout models

How can understanding TMUB1's role in cholesterol trafficking inform metabolic disease research?

Recent findings link TMUB1 to cholesterol metabolism through interactions with ERLIN scaffolds:

  • ERLIN scaffolds mediate interaction between TMUB1 and RNF170

  • This complex plays a role in limiting cholesterol esterification, thereby favoring cholesterol transport from the ER to the Golgi apparatus

  • These interactions influence Golgi morphology and the secretory pathway

This emerging area connects TMUB1 to metabolic processes and opens potential avenues for investigation in metabolic disorders, particularly those involving lipid metabolism and trafficking.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.