Recombinant Human Transmembrane anterior posterior transformation protein 1 homolog (TAPT1)

Shipped with Ice Packs
In Stock

Description

Introduction and Overview

Recombinant Human Transmembrane Anterior Posterior Transformation Protein 1 Homolog (TAPT1) is a bioengineered protein derived from the human TAPT1 gene (UniProt ID: Q6NXT6). Expressed in E. coli as a full-length mature protein (amino acids 2–567), it is His-tagged to facilitate purification and structural studies . This recombinant version retains the native protein’s eight transmembrane helices and is critical for research into its roles in cellular signaling, extracellular matrix (ECM) regulation, and disease mechanisms .

Functional Insights

  • Flavonoid Transport: Molecular docking suggests TAPT1 binds flavonoid glycosides, potentially influencing antioxidant signaling or ECM modulation .

  • Ciliogenesis and Signaling: Implicated in primary cilia formation and downstream HOXC8-mediated axial patterning .

Protein Partners

PartnerFunctionInteraction Score
HOXC8Homeobox transcription factor regulating anterior-posterior axis .0.811
SUCOOssification factor regulating collagen synthesis in osteoblasts .0.686
CSTF1Polyadenylation factor involved in mRNA processing .0.808

Pathway Involvement

  • ECM Regulation: TAPT1 mutations disrupt collagen type I assembly, leading to osteogenesis imperfecta (OI) .

  • WNT/SFRP1 Signaling: Altered TAPT1 stability upregulates SFRP1, a WNT antagonist, impairing bone remodeling .

Disease Associations

ConditionMechanismMutation Impact
Osteogenesis ImperfectaCollagen type I misfolding due to disrupted ECM organization .p.Leu108Trp (c.323T>G) reduces protein stability .
Progeroid SyndromeNonsense-mediated decay of TAPT1 mRNA, causing premature aging .c.1237−52G>A (deep intronic variant) .
CancerSomatic mutations in breast, lung, and liver cancers .Missense/nonsense variants .

Collagen Defects

  • Electron Microscopy Findings: Patient-derived TAPT1-mutant cells show disorganized collagen fibrils, failing to form banded structures .

  • Secretion Kinetics: Delayed collagen secretion and reduced deposition in cell culture .

Detection Methods

  • ELISA Kits: Quantitative measurement of TAPT1 in lysates/fluids (range: 0.156–10 ng/mL) .

  • Western Blotting: Commercial antibodies validate protein loss in TAPT1-null patient cells .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please notify us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
TAPT1; CMVFR; Transmembrane anterior posterior transformation protein 1 homolog; Cytomegalovirus partial fusion receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-567
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
AGVGDAAAPGEGGGGGVDGPQRDGRGEAEQPGGSGGQGPPPAPQLTETLGFYESDRRRER RRGRTELSLLRFLSAELTRGYFLEHNEAKYTERRERVYTCLRIPRELEKLMVFGIFLCLD AFLYVFTLLPLRVFLALFRLLTLPCYGLRDRRLLQPAQVCDILKGVILVICYFMMHYVDY SMMYHLIRGQSVIKLYIIYNMLEVADRLFSSFGQDILDALYWTATEPKERKRAHIGVIPH FFMAVLYVFLHAILIMVQATTLNVAFNSHNKSLLTIMMSNNFVEIKGSVFKKFEKNNLFQ MSNSDIKERFTNYVLLLIVCLRNMEQFSWNPDHLWVLFPDVCMVIASEIAVDIVKHAFIT KFNDITADVYSEYRASLAFDLVSSRQKNAYTDYSDSVARRMGFIPLPLAVLLIRVVTSSI KVQGILSYACVILFYFGLISLKVLNSIVLLGKSCQYVKEAKMEEKLSNPPATCTPGKPSS KSQNKCKPSQGLSTEENLSASITKQPIHQKENIIPLLVTSNSDQFLTTPDGDEKDITQDN SELKHRSSKKDLLEIDRFTICGNRID
Uniprot No.

Target Background

Function
TAPT1 plays a crucial role in primary cilia formation. It might act as a downstream effector of HOXC8, potentially by relaying or transmitting extracellular information essential for axial skeletal patterning during development. TAPT1 may be involved in cartilage and bone development and could contribute to the differentiation of cranial neural crest cells. In the context of microbial infection, TAPT1 might act as a fusion receptor for cytomegalovirus (HCMV) strain AD169.
Gene References Into Functions
  1. A perinatal lethal mutation in mouse Tapt1 results in homeotic, posterior-to-anterior transformations of the axial skeleton. PMID: 17151244
Database Links

HGNC: 26887

OMIM: 612758

KEGG: hsa:202018

STRING: 9606.ENSP00000385347

UniGene: Hs.479223

Involvement In Disease
Osteochondrodysplasia, complex lethal, Symoens-Barnes-Gistelinck type (OCLSBG)
Protein Families
TAPT1 family
Subcellular Location
Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Cytoplasm, cytoskeleton, cilium basal body. Membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of TAPT1 protein?

TAPT1 is an evolutionarily conserved transmembrane protein with a complex secondary structure. Advanced computational modeling reveals that TAPT1 contains eight transmembrane helices within a total of 27 helices in its secondary structure . The protein consists of 567 amino acids, and specific residues including H235, R323, K443, N446, S447, L450, K453, S454, Y457, K511, N513, D533, K535, D536, and T538 form the pore surface and are involved in substrate binding interactions . In the absence of a high-resolution X-ray crystallographic structure, researchers typically employ ab initio modeling methods to generate reliable 3D structural models, which can then be validated using assessment tools such as RAMPAGE, PROCHECK, and ERRAT .

Where is TAPT1 localized in the cell?

TAPT1 demonstrates complex subcellular localization patterns that are critical for its various functions. Immunofluorescence studies reveal that wild-type TAPT1 primarily localizes to the centrosome and/or ciliary basal body . This localization is functionally significant as mutations in TAPT1 cause the protein to mislocalize to the cytoplasm, disrupting normal cellular functions . Computational prediction methods, such as LocTree3, suggest TAPT1 may also localize to the mitochondrial membrane with an expected accuracy of 84% . For researchers studying TAPT1 localization, immunocytochemical staining with antibodies against TAPT1 (such as Sigma HPA042567) and co-staining with markers for cellular structures (like α-acetylated tubulin for cilia, Golph4 for Golgi apparatus, and γ-tubulin for centrosomes) provides reliable visualization of localization patterns .

What developmental processes involve TAPT1?

TAPT1 plays critical roles in several developmental processes, particularly in skeletal patterning and organogenesis. Animal model studies demonstrate that TAPT1 is essential for proper axial skeletal patterning, as evident in Tapt1-mutant mice which exhibit posterior-to-anterior transformations of the vertebral column midsection . Despite this specific phenotype, TAPT1 expression is ubiquitous throughout embryonic development (E7-E17) and in adult tissues . Additionally, TAPT1 is crucial for craniofacial development, as knockdown of tapt1b in zebrafish induces severe craniofacial cartilage malformations and delayed ossification, associated with aberrant differentiation of cranial neural crest cells . The protein also plays important roles in the development of other organs including the brain, lungs, and kidneys, as evidenced by developmental anomalies in these organs when TAPT1 is defective .

How does TAPT1 regulate BMP signaling?

TAPT1 functions as a negative regulator of the bone morphogenetic protein (BMP) signaling pathway, which is pivotal for embryogenesis and adult homeostasis. Mechanistically, TAPT1 inhibits BMP signaling by destabilizing SMAD1/5 proteins through facilitation of their interaction with SMURF1 E3 ubiquitin ligase, leading to proteasomal degradation of SMAD1/5 . Interestingly, the relationship between TAPT1 and BMP signaling is bidirectional—activation of BMP signaling facilitates redistribution of TAPT1 and promotes its association with SMAD1 . To study this interaction experimentally, researchers can use co-immunoprecipitation assays with TAPT1 antibodies to identify protein-protein interactions, western blotting to monitor SMAD1/5 protein levels, and ubiquitination assays to assess SMURF1-mediated ubiquitination of SMAD1/5 in the presence and absence of TAPT1 .

What is the relationship between TAPT1 and ciliogenesis?

TAPT1 plays an essential role in ciliogenesis, and its dysfunction leads to ciliopathies. Research demonstrates that wild-type TAPT1 localizes to the centrosome and/or ciliary basal body, critical structures for cilium formation . When TAPT1 is defective, it mislocalizes to the cytoplasm, disrupting normal primary cilium formation . This disruption appears to be related to TAPT1's effects on Golgi morphology and trafficking, as these processes are also impaired in cells with defective TAPT1 . To investigate TAPT1's role in ciliogenesis, researchers can use siRNA knockdown approaches in cell models, followed by immunofluorescence staining for ciliary markers like acetylated tubulin. Quantification of cilia formation rates and measuring ciliary length provide valuable metrics for assessing the effects of TAPT1 manipulation on ciliogenesis .

What animal models are most effective for TAPT1 research?

Multiple animal models provide valuable insights into TAPT1 function, each with specific advantages. Zebrafish models are particularly useful for studying TAPT1's role in development, as knockdown of tapt1b in zebrafish produces observable phenotypes including severe craniofacial cartilage malformations and delayed ossification . This model allows for relatively rapid assessment of developmental effects and is amenable to high-throughput studies. For mammalian development research, mouse models with Tapt1 mutations demonstrate posterior-to-anterior transformations of the vertebral column, providing insights into TAPT1's role in skeletal patterning . When establishing these models, researchers should consider using targeted gene editing approaches such as CRISPR-Cas9 for generating specific mutations, or morpholino antisense oligonucleotides for transient knockdown in zebrafish embryos .

What cell culture systems are appropriate for TAPT1 functional studies?

Several cell culture systems have proven effective for investigating TAPT1 function. Human dermal fibroblasts from both control individuals and patients with TAPT1 mutations provide valuable models for studying pathogenic mechanisms . Bone-related cell lines such as MG-63 osteosarcoma cells are useful for investigating TAPT1's role in bone development and mineralization . HEK293T cells are commonly employed for overexpression studies due to their high transfection efficiency . For functional knockdown studies, siRNA approaches have demonstrated effectiveness, with reported knockdown efficiencies ranging from 72% to 84.45% depending on the specific siRNA construct used . When designing cell culture experiments, researchers should include appropriate controls and validate knockdown or overexpression efficiency through qPCR and western blot analysis .

What methods are most effective for analyzing TAPT1 protein interactions?

To investigate TAPT1 protein interactions, immunoprecipitation (IP) coupled with western blot analysis provides reliable results. Researchers can use commercially available TAPT1 antibodies (such as Sigma HPA042567) bound to Dynabeads Protein A for pull-down assays . Following elution, western blot analysis can identify interacting proteins. For studying specific interactions with proposed partners like SMAD1/5 or SMURF1, co-immunoprecipitation experiments with antibodies against these proteins can confirm binding relationships . Proximity ligation assays offer another approach for visualizing protein interactions in situ. For computational prediction of interactions, techniques such as molecular docking analysis can identify potential binding partners—for example, this approach predicted flavonoid glycosides as possible TAPT1 substrates with the lowest binding energy in docking studies .

What computational methods can predict TAPT1 substrates and binding sites?

For predicting TAPT1 substrates and binding sites, researchers can implement a systematic computational approach. First, analysis of the protein's pore characteristics and transport properties using tools like TrSSP can indicate the types of molecules TAPT1 might transport (e.g., charged molecules) . Next, molecular docking analysis using software such as AutoDock Vina can be performed against databases of potential substrates like the Human Metabolome Database (HMDB) . When configuring docking parameters, researchers should define appropriate grid box dimensions (e.g., 75×100×75 Å) centered on the predicted binding site . Analysis of docking results should focus on binding energy scores and interaction patterns. For TAPT1, this approach identified flavonoid glycosides as potential substrates with the lowest binding energies . The binding interactions can be visualized using PyMOL, and binding site predictions can be validated using tools such as CASTp . Finally, pathway analysis tools like Ingenuity Pathway Analysis (IPA) can help contextualize substrate predictions within relevant biological pathways .

What phenotypes are associated with TAPT1 mutations in humans?

TAPT1 mutations in humans cause a complex congenital syndrome with overlapping features of lethal skeletal dysplasias and ciliopathies . The primary characteristics include:

  • Fetal lethality

  • Severe hypomineralization of the entire skeleton

  • Intra-uterine fractures

  • Multiple congenital developmental anomalies affecting the brain, lungs, and kidneys

At the cellular level, defective TAPT1 mislocalizes to the cytoplasm rather than to the centrosome/basal body, disrupting Golgi morphology and trafficking as well as normal primary cilium formation . These cellular defects underlie the severe developmental abnormalities observed in affected individuals. For researchers investigating these phenotypes, histological analysis of affected tissues, immunofluorescence studies of cellular localization, and functional assays of Golgi trafficking provide valuable insights into pathogenic mechanisms .

How do mutations in TAPT1 affect BMP signaling in skeletal disorders?

Mutations in TAPT1 disrupt normal regulation of BMP signaling, which plays a critical role in skeletal development. In normal conditions, TAPT1 inhibits BMP signaling by facilitating the interaction between SMAD1/5 and SMURF1 E3 ubiquitin ligase, leading to proteasomal degradation of SMAD1/5 . When TAPT1 is mutated, this regulatory mechanism is impaired, potentially leading to dysregulated BMP signaling that affects proper skeletal patterning and mineralization . This dysregulation likely contributes to the severe skeletal phenotypes observed in patients with TAPT1 mutations, including hypomineralization and intra-uterine fractures . To investigate these effects experimentally, researchers can measure SMAD1/5 phosphorylation levels, assess BMP target gene expression using qPCR, and evaluate mineralization capacity in cellular models with TAPT1 mutations or knockdown .

How might TAPT1 function in mitochondrial membranes?

Although TAPT1 is primarily known for its localization to the centrosome/basal body, computational prediction suggests it may also localize to mitochondrial membranes with an expected accuracy of 84% . This potential dual localization raises intriguing questions about TAPT1's function in mitochondria. As a transmembrane protein with predicted transport capabilities for charged molecules, TAPT1 might be involved in mitochondrial transport mechanisms, potentially affecting energy metabolism, calcium homeostasis, or redox balance . To investigate this hypothesis, researchers should employ mitochondrial fractionation techniques followed by western blot analysis to confirm TAPT1's presence in mitochondrial membranes. Co-localization studies using confocal microscopy with mitochondrial markers (such as MitoTracker) and TAPT1 antibodies can provide spatial confirmation. Functional assays measuring mitochondrial membrane potential, respiratory capacity, or metabolite transport in cells with normal versus altered TAPT1 expression would help elucidate TAPT1's role in mitochondrial function .

What is the relationship between TAPT1 and flavonoid transport?

Computational modeling and molecular docking studies predict flavonoid glycosides as potential substrates for TAPT1, with the highest binding affinity among charged metabolites in the Human Metabolome Database . The binding interaction involves specific amino acid residues including A220, W223, T224, I239, R323, K443, S447, L450, N513, and P516 . This finding suggests TAPT1 might function as a flavonoid transporter, which could have significant implications for cellular processes affected by these bioactive compounds. To experimentally validate this prediction, researchers could develop transport assays using radiolabeled or fluorescently tagged flavonoids in cell systems with varying TAPT1 expression levels. Site-directed mutagenesis of the predicted binding residues, followed by transport assays, could confirm their functional significance. Additionally, researchers should investigate whether flavonoid transport by TAPT1 influences BMP signaling or other pathways, potentially linking TAPT1's transport function with its role in development and disease .

How does BMP signaling regulate TAPT1 localization and function?

While TAPT1 inhibits BMP signaling, research indicates that BMP signaling activation reciprocally affects TAPT1 by facilitating its redistribution and promoting its association with SMAD1 . This bidirectional relationship suggests a complex regulatory loop between TAPT1 and BMP signaling. To investigate this mechanism, researchers should design time-course experiments treating cells with BMP ligands (such as BMP2 or BMP4) and tracking TAPT1 localization using immunofluorescence microscopy. Co-immunoprecipitation assays at different time points post-BMP treatment can quantify the kinetics of TAPT1-SMAD1 association. Researchers should also explore whether specific post-translational modifications of TAPT1 occur after BMP stimulation, potentially explaining its redistribution. Understanding this regulatory mechanism could provide insights into how BMP signaling dynamically controls its own negative regulator, which has implications for both normal development and pathological conditions involving disrupted BMP signaling .

What approaches are most effective for TAPT1 knockdown studies?

For TAPT1 knockdown studies, RNA interference (RNAi) techniques have demonstrated high efficiency. Specifically, siRNA approaches using ON-TARGETplus Human TAPT1 siRNA - SMART pool (Thermo Fisher Scientific) have achieved knockdown efficiencies of up to 72% . Alternative siRNA constructs show varying efficiencies, with TRCN0000134168 reaching 29.40% knockdown and others showing even higher efficiency . When designing knockdown experiments:

  • Use appropriate transfection reagents (e.g., DharmaFECT 1 siRNA Transfection Reagent at 1/666 dilution)

  • Optimize cell seeding density (e.g., 30,000 cells/well in 8-chamber glass slides)

  • Allow 24 hours post-transfection before further treatments

  • Validate knockdown efficiency using qPCR and western blot analysis

  • Include appropriate non-targeting siRNA controls (e.g., ON-TARGETplus siCONTROL Non-Targeting Pool)

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.