Recombinant Human Transmembrane epididymal protein 1 (TEDDM1)

Shipped with Ice Packs
In Stock

Description

Protein Structure

TEDDM1 (UniProt: Q810U2) spans 273–305 amino acids, depending on the species, and contains:

  • Six transmembrane regions (alpha-helical), critical for membrane integration .

  • DUF716 domain (amino acids 95–219): A conserved region with a leucine zipper motif, likely involved in protein dimerization and functional activity .

  • Post-translational modifications: Predicted phosphorylation (18 sites), N-glycosylation, and N-myristylation sites, suggesting roles in protein stability, signaling, and membrane dynamics .

Tissue Expression

TEDDM1 is expressed in multiple tissues, including the testis (high levels), epididymis, and brain regions (e.g., amygdala, hippocampus) . In humans, it is also detected in keratinocytes and linked to microRNA-31 regulation during embryonic development .

Recombinant Production and Biochemical Properties

Recombinant TEDDM1 proteins are typically produced in bacterial or mammalian systems to study its structure-function relationships. Below is a comparison of available recombinant variants (human data limited; examples from mouse/rat):

SpeciesSourceTagLengthPurityApplicationsSource
MouseE. coliHis1–305>90%SDS-PAGE, Western blotting
RatMammalian cellsHisFull>80%Functional studies
MouseHEK-293 cellsHis1–305CustomELISA, WB

Key Observations:

  • His-tagged variants: Facilitate purification via nickel affinity chromatography .

  • Trehalose additives: Stabilize lyophilized proteins during storage .

  • Cell-free synthesis: Used for complex proteins (e.g., Strep-tagged mouse TEDDM1) .

Experimental Uses

Recombinant TEDDM1 is employed in:

  • Structural studies: SDS-PAGE and Western blotting to confirm expression and purity .

  • Interaction mapping: Co-IP or pull-down assays to identify binding partners (e.g., SBK2, METTL7B, TSPAN1) .

  • Functional assays: Investigating roles in sperm maturation, cellular adhesion, or cancer progression .

Interacting Proteins and Pathways

Predicted partners include:

ProteinFunctionSource
SBK2MAPK cascade, protein phosphorylation
TSPAN1Tetraspanin-mediated signal transduction
EDDM3BSperm maturation in the epididymis

Cancer Associations

  • Hepatocellular carcinoma (HCC): TEDDM1 expression correlates with hepatitis B virus-related HCC, suggesting a role in liver cancer progression .

  • MicroRNA regulation: Inhibition of miR-31, a regulator of embryonic implantation, links TEDDM1 to developmental and oncogenic pathways .

Reproductive Biology

  • Sperm maturation: Interactions with EDDM3B in the epididymis imply a role in reproductive health .

  • Embryonic development: Potential involvement in miRNA-mediated implantation .

Research Gaps

  • Human-specific data: Limited recombinant human TEDDM1 studies; most insights derive from murine/rat models .

  • Functional elucidation: The DUF716 domain’s exact role remains uncharacterized .

Potential Applications

  • Therapeutic targets: Inhibiting TEDDM1-miR-31 interactions for cancer treatment .

  • Biomarkers: Monitoring TEDDM1 expression in HCC or infertility diagnostics .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have any specific format requirements, please indicate them in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
TEDDM1; HE9; Transmembrane epididymal protein 1; Human epididymis-specific protein 9; He9
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-273
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
TEDDM1
Target Protein Sequence
MILKGCLLYPLCSPRNKQRCARLWKIAYGGLLKIVTGSLLTFYVVLCLDGGMVLMRKQVP SRFMYPKEWQHLTMFILLTLNGCVDFMSKNVLPQRCVGLEKGTLVLIIYELLLLMVSHVK DSEGVELHVYSLLILVVFLLLLVLTAELWAPNMCHLQLMETFLILMMGSWLMQAGFILYR PVSGYPWQDDDISDIMFVTTFFCWHVMINASFLLGIYGFSSFWYHCFRPSLKLTGPKEAP YYASTPGPLYKLLQEVEQSEKEDQALLLPKSSP
Uniprot No.

Target Background

Database Links

HGNC: 30233

KEGG: hsa:127670

UniGene: Hs.156977

Protein Families
TMEM45 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is TEDDM1 and what are its structural characteristics?

TEDDM1 (Transmembrane epididymal protein 1) is a 273 amino acid multi-pass membrane protein that belongs to the TMEM45 family. It contains six alpha-helix transmembrane regions and a 118 amino acid length family domain of unknown function. TEDDM1 is also commonly known as TMEM45C, HE9 (human epididymis-specific protein 9), EDDM9, and several other aliases in scientific literature . The protein has a molecular weight of approximately 31.3 kDa and a theoretical isoelectric point (pI) of 8.02 . As a transmembrane protein, TEDDM1 is predicted to be an integral component of the plasma membrane, though its exact topology and structural organization remain to be fully characterized.

What is the genomic location and organization of the TEDDM1 gene?

The TEDDM1 gene is located on the long arm of human chromosome 1 at position 1q25.3 on the minus strand . Interestingly, the gene is composed of a single exon, which is somewhat unusual as most human genes contain multiple exons . The gene that encodes TEDDM1 contains approximately 2,500 bases . In terms of its genomic neighborhood, TEDDM1 is situated near several other genes, including glutamate-ammonia ligase (GLUL), long intergenic non-protein coding RNA 272 (LINC00272), and Sharpr-MPRA regulatory region 13543 (LOC122149321) .

What are the optimal expression systems for producing recombinant TEDDM1?

Based on insights from similar transmembrane proteins, the expression of recombinant TEDDM1 likely presents several challenges. While there are no direct studies on TEDDM1 expression systems in the provided search results, the experience with similar proteins suggests that prokaryotic systems often result in accumulation in inclusion bodies due to improper folding of transmembrane domains. For instance, when expressing the sperm-binding protein BSPH1 with an N-terminal hexahistidine tag in BL21(DE3) E. coli cells, the protein accumulated in inclusion bodies .

For transmembrane proteins like TEDDM1, expression in eukaryotic systems such as mammalian cells (HEK293, CHO), insect cells (Sf9, Sf21), or yeast (Pichia pastoris) might yield better results due to their ability to perform post-translational modifications and provide appropriate membrane insertion machinery. When prokaryotic systems must be used, specialized strains such as Origami B(DE3)pLysS cells, which favor disulfide bond formation, combined with fusion partners like thioredoxin, may improve soluble protein yield as demonstrated with the BSPH1 protein .

What purification strategies are most effective for recombinant TEDDM1?

Purification of recombinant TEDDM1 requires careful consideration of its membrane-bound nature. Although specific purification protocols for TEDDM1 are not detailed in the search results, effective approaches for similar transmembrane proteins typically involve:

  • Affinity chromatography: Expression with an affinity tag (His6, GST, MBP) followed by respective affinity purification can be a first step. For TEDDM1, a His6-thioredoxin fusion tag approach may be beneficial, as this strategy proved successful for the soluble expression and purification of BSPH1 .

  • Detergent solubilization: Careful selection of detergents (DDM, CHAPS, Triton X-100) is crucial for extracting membrane proteins while maintaining their native conformation.

  • Size exclusion chromatography: This can help separate monomeric protein from aggregates that may form during expression and initial purification steps.

  • Ion exchange chromatography: Given TEDDM1's theoretical pI of 8.02, cation exchange chromatography might be effective for further purification under appropriate pH conditions.

The purification strategy would need optimization based on the expression system used and the intended downstream applications of the recombinant protein.

How can researchers confirm the proper folding and functionality of recombinant TEDDM1?

Confirming proper folding and functionality of recombinant TEDDM1 would involve multiple complementary approaches:

  • Structural assessment:

    • Circular dichroism (CD) spectroscopy to evaluate secondary structure content (expected to show patterns consistent with alpha-helical transmembrane domains)

    • Thermal stability assays to assess protein folding integrity

    • Limited proteolysis patterns compared to native protein

  • Functional validation:

    • Lipid binding assays, particularly with phosphatidylcholine liposomes, which may interact with TEDDM1 similar to other membrane proteins

    • Protein-protein interaction studies with potential binding partners in reproductive tissues

    • Cell-based assays examining localization to plasma membrane when expressed in mammalian cells

  • Immunological verification:

    • Western blotting with antibodies against TEDDM1 or epitope tags

    • Conformational antibodies that recognize properly folded protein

Given TEDDM1's predicted role in the plasma membrane, reconstitution into liposomes or nanodiscs followed by functional assays would provide strong evidence of proper folding and functional activity.

What techniques are most suitable for studying TEDDM1's membrane topology?

Determining the membrane topology of TEDDM1 is essential for understanding its function. Several complementary techniques can be employed:

  • Computational prediction algorithms:

    • TMHMM, HMMTOP, and Phobius can predict transmembrane helices and their orientation

    • SignalP can identify potential signal peptides at the N-terminus

  • Experimental approaches:

    • Protease protection assays: Limited proteolysis of intact cells, microsomes, or reconstituted proteoliposomes, followed by mass spectrometry identification of protected fragments

    • Selective permeabilization combined with immunofluorescence using antibodies against different protein regions

    • Glycosylation mapping: Introduction of artificial N-glycosylation sites throughout the protein to determine which regions are exposed to the ER lumen during biosynthesis

  • Cysteine scanning mutagenesis:

    • Sequential replacement of amino acids with cysteine residues followed by accessibility studies using membrane-impermeable sulfhydryl reagents

  • Fusion protein approaches:

    • Fusion of reporter proteins (GFP, alkaline phosphatase, β-lactamase) to different regions to determine their cellular localization

These techniques collectively can generate a detailed model of TEDDM1's orientation within the membrane, identifying cytoplasmic, transmembrane, and extracellular/luminal domains.

What RNA interference approaches are effective for TEDDM1 functional studies?

RNA interference (RNAi) techniques offer powerful tools for investigating TEDDM1 function through loss-of-function studies:

  • siRNA design considerations:

    • Commercial siRNAs targeting TEDDM1 are available, such as the TEDDM1 siRNA (m): sc-154176 mentioned in the search results

    • Custom siRNAs should target unique regions within the TEDDM1 mRNA sequence, avoiding sequence homology with other TMEM family members

    • Multiple siRNAs targeting different regions of the transcript should be tested to confirm specificity of knockdown effects

  • Delivery methods:

    • Lipofection is suitable for most cell lines expressing TEDDM1

    • Electroporation may be more effective for hard-to-transfect cells

    • Viral vectors (lentivirus, adenovirus) can be used for stable knockdown or for primary cells

  • Validation of knockdown:

    • qRT-PCR to quantify mRNA reduction

    • Western blotting to confirm protein depletion

    • Rescue experiments with siRNA-resistant TEDDM1 constructs to confirm specificity

  • Experimental design recommendations:

    • Include appropriate negative controls (non-targeting siRNA)

    • Establish dose-response and time-course studies to determine optimal knockdown conditions

    • Consider potential compensation by other TMEM family members

For long-term studies, CRISPR/Cas9-mediated gene editing may provide more stable and complete loss of TEDDM1 expression compared to transient siRNA approaches.

What are the challenges in developing specific antibodies against TEDDM1?

Developing specific antibodies against transmembrane proteins like TEDDM1 presents several technical challenges:

  • Antigen design considerations:

    • Hydrophobic transmembrane regions are poor immunogens

    • Extracellular/luminal loops or N/C-terminal domains are preferred epitope targets

    • Synthetic peptides corresponding to hydrophilic regions can be used

    • Recombinant fragments expressing extracellular domains may generate more specific antibodies

  • Production strategies:

    • Monoclonal antibodies offer higher specificity but require screening numerous hybridoma clones

    • Polyclonal antibodies may recognize multiple epitopes but risk cross-reactivity with related proteins

    • Recombinant antibody technologies (phage display, yeast display) can be used to develop antibodies against conserved or weakly immunogenic regions

  • Validation requirements:

    • Western blotting against recombinant protein and tissue lysates

    • Immunoprecipitation to confirm native protein recognition

    • Immunohistochemistry/immunofluorescence with appropriate controls

    • Testing in TEDDM1 knockout or knockdown samples

  • Common pitfalls:

    • Cross-reactivity with other TMEM family members

    • Epitope masking due to protein-protein interactions or post-translational modifications

    • Fixation-sensitive epitopes in imaging applications

    • Batch-to-batch variability with polyclonal antibodies

Development of well-validated antibodies is critical for advancing TEDDM1 research, particularly for studies of protein localization, expression patterns, and protein-protein interactions.

How can researchers analyze TEDDM1 expression data from large-scale transcriptomic studies?

Analysis of TEDDM1 expression from transcriptomic datasets requires careful bioinformatic approaches:

  • Data normalization strategies:

    • Consider tissue-specific normalization methods as TEDDM1 shows differential expression across tissues

    • Account for batch effects in meta-analyses across multiple datasets

    • Apply appropriate transformation methods (log2, quantile normalization) based on data distribution

  • Expression analysis workflow:

    • Identify TEDDM1 transcripts using current gene annotations (Ensembl, NCBI)

    • Examine tissue-specific expression patterns and compare with established profiles

    • Investigate co-expressed genes for functional network analysis

    • Apply dimensionality reduction techniques like those mentioned in search result to identify expression patterns across large datasets

  • Differential expression analysis:

    • Compare TEDDM1 expression across developmental stages, disease states, or experimental conditions

    • Calculate statistical significance using appropriate tests (t-test, ANOVA, DESeq2, edgeR)

    • Control for multiple testing using FDR or Bonferroni correction

  • Visualization approaches:

    • Generate heatmaps of TEDDM1 expression across tissues/conditions

    • Create box plots or violin plots to show expression distribution

    • Use dimensionality reduction visualization (PCA, t-SNE, UMAP) to place TEDDM1 in broader expression contexts

When analyzing single-cell RNA-seq data, researchers should be aware of potential dropout effects that may affect detection of moderately expressed genes like TEDDM1 in specific cell types.

What evolutionary insights can be gained from comparative analysis of TEDDM1 across species?

Comparative genomic analysis of TEDDM1 across species can provide valuable evolutionary insights:

  • Ortholog identification:

    • Use resources like HomoloGene (mentioned in search result ) and OrthoDB to identify TEDDM1 orthologs

    • Distinguish between true orthologs and paralogous TMEM family members

    • Assess conservation patterns across vertebrates and potential invertebrate homologs

  • Sequence conservation analysis:

    • Perform multiple sequence alignments to identify conserved domains and motifs

    • Calculate selection pressure (dN/dS ratios) across different protein regions

    • Identify species-specific variations that may relate to reproductive adaptations

  • Synteny analysis:

    • Examine conservation of genomic context around TEDDM1 across species

    • Identify potential regulatory elements through comparative genomics

  • Structure-function relationships:

    • Map conserved residues onto predicted structural models

    • Identify functionally constrained regions versus rapidly evolving segments

    • Correlate evolutionary patterns with expression domains across species

The mouse ortholog of TEDDM1 mentioned in search result provides a starting point for comparative studies, particularly for researchers considering mouse models for functional investigation.

How might TEDDM1 function in reproductive biology and fertility?

Given TEDDM1's high expression in testis and epididymis, several research directions could elucidate its role in reproduction:

  • Potential functions in sperm maturation:

    • Investigation of TEDDM1 interaction with sperm surface during epididymal transit

    • Analysis of TEDDM1 knockout/knockdown effects on sperm parameters (motility, capacitation, acrosome reaction)

    • Comparison with better-characterized epididymal proteins like BSPH1

  • Mechanistic studies:

    • Identification of TEDDM1 binding partners in reproductive tissues

    • Characterization of potential roles in membrane remodeling during sperm maturation

    • Investigation of signaling pathways potentially regulated by TEDDM1

  • Clinical correlations:

    • Analysis of TEDDM1 expression or genetic variants in infertility patients

    • Evaluation as a potential biomarker for specific forms of male infertility

    • Assessment of immunological responses to TEDDM1 in reproductive pathologies

  • Therapeutic implications:

    • Potential as a target for male contraception development

    • Recombinant TEDDM1 as a diagnostic tool in reproductive medicine

Development of animal models with conditional TEDDM1 knockout specifically in reproductive tissues would provide valuable insights into its physiological significance in fertility.

What technologies are emerging for studying transmembrane proteins like TEDDM1?

Emerging technologies are expanding our ability to study challenging transmembrane proteins like TEDDM1:

  • Structural biology advances:

    • Cryo-electron microscopy for membrane protein structures without crystallization

    • Microcrystal electron diffraction (MicroED) for small crystals of membrane proteins

    • Advanced NMR methodologies for membrane protein dynamics

  • Protein engineering approaches:

    • Nanobody development for stabilizing membrane proteins in native conformations

    • Directed evolution to develop stable variants for structural and functional studies

    • Cell-free expression systems with defined lipid environments

  • Imaging innovations:

    • Super-resolution microscopy techniques (STORM, PALM, STED) for precise localization

    • Label-free imaging approaches to study native protein behavior

    • Live-cell protein tracking with minimal tags

  • Functional screening platforms:

    • High-throughput assays in reconstituted membrane systems

    • CRISPR screens targeting trafficking or interacting partners

    • Computational modeling and simulation of membrane protein dynamics

These technologies could overcome traditional challenges in studying membrane proteins like TEDDM1, potentially accelerating our understanding of its structure, interactions, and functions.

What is the current state of TEDDM1 research and key knowledge gaps?

The current state of TEDDM1 research reveals significant knowledge gaps:

What integrated research approaches would advance TEDDM1 knowledge most effectively?

Advancing TEDDM1 research requires integrated approaches across multiple disciplines:

  • Recommended research strategy:

    • Establish reliable expression and purification protocols for recombinant TEDDM1, potentially adapting the His6-thioredoxin fusion approach successful for other proteins

    • Develop and validate specific antibodies and knockout models

    • Combine structural studies with functional assays in relevant cell types

    • Integrate computational predictions with experimental validation

  • Collaborative framework:

    • Reproductive biologists to investigate physiological functions

    • Structural biologists to determine membrane topology and structure

    • Cell biologists to characterize subcellular localization and trafficking

    • Bioinformaticians to analyze expression patterns across conditions and species

  • Translational considerations:

    • Investigate associations with specific pathologies, particularly in reproductive medicine

    • Assess potential as a diagnostic biomarker or therapeutic target

    • Develop screening assays for compounds that modulate TEDDM1 function

  • Technological priorities:

    • Optimize recombinant expression systems for structural and functional studies

    • Develop cell and animal models with conditional TEDDM1 manipulation

    • Apply advanced imaging techniques to study dynamics in native contexts

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.