Recombinant Human Transmembrane protein 116 (TMEM116)

Shipped with Ice Packs
In Stock

Description

Comparative Genomics and Conservation

The mouse homolog of human TMEM116, known as Tmem116 (MGI:1924712), provides insights into the evolutionary conservation of this protein across species . Comparative genomic analysis suggests that TMEM116 has been conserved throughout mammalian evolution, indicating its potential functional importance. GPR157 has been identified as an important paralog of TMEM116 , suggesting possible shared evolutionary origins or functional similarities.

Production and Characterization of Recombinant TMEM116

Recombinant Human TMEM116 protein can be produced through various expression systems for research applications. The production methods and specifications vary depending on the intended use and experimental requirements.

Expression Systems and Production Methods

Recombinant TMEM116 can be expressed in different host systems, including Escherichia coli (E. coli) and wheat germ . When expressed in E. coli, the protein is often fused with an N-terminal His tag to facilitate purification and detection . Alternatively, wheat germ expression systems can be employed, particularly when post-translational modifications more closely resembling those in mammalian cells are desired .

Physical and Biochemical Properties

The commercially available recombinant TMEM116 protein typically comes in the form of a lyophilized powder, which requires reconstitution before use . The following table summarizes the key specifications of recombinant human TMEM116 protein:

PropertySpecification
SpeciesHuman
SourceE. coli or Wheat germ
TagHis (N-terminal)
Protein LengthFull Length (1-245 aa)
FormLyophilized powder
Purity>90% (SDS-PAGE)
ApplicationsSDS-PAGE, ELISA, Western Blot
Storage-20°C/-80°C
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0

These properties ensure the stability and functionality of the recombinant protein for various experimental applications .

Functional Significance of TMEM116

The biological functions of TMEM116 are still being elucidated, but emerging research has begun to shed light on its roles in cellular processes and disease mechanisms.

Role in Cellular Communication and Signaling

As a member of the transmembrane protein family, TMEM116 is believed to participate in cellular communication by facilitating the transmission of signals between the extracellular environment and intracellular compartments . This function is critical for numerous cellular processes, including development, differentiation, and responses to external stimuli.

Involvement in Cell Motility and Proliferation

Recent research has uncovered a significant role for TMEM116 in regulating cell motility and proliferation, particularly in the context of cancer cells . Studies have shown that TMEM116 deficiency inhibits scattered cell growth, clone formation, cell proliferation, invasion, and migration . These findings suggest that TMEM116 may function as a positive regulator of cellular movement and division, with important implications for understanding its role in health and disease.

Signaling Pathway Interactions

TMEM116 has been implicated in the PDK1-AKT-FOXO3A signaling pathway, a key regulator of cellular processes including growth, survival, and metabolism . Research indicates that deficiency of TMEM116 inhibits this signaling pathway, resulting in the accumulation of TAp63, a protein involved in cell cycle regulation and apoptosis . This interaction positions TMEM116 as a critical integrator of oncogenic signaling in cellular processes related to cancer development and progression.

TMEM116 in Disease Pathology

The expression and function of TMEM116 have been associated with various pathological conditions, most notably cancer and endometriosis.

Role in Cancer Development and Progression

TMEM116 has been found to be highly expressed in non-small-cell lung cancer (NSCLC) tissues and cell lines, suggesting a potential role in the development or progression of this malignancy . Experimental evidence indicates that inactivation of TMEM116 reduces cell proliferation, migration, and invasiveness of human cancer cells . Furthermore, suppression of TMEM116 has been shown to inhibit A549-induced tumor metastasis in mouse lungs . These findings collectively suggest that TMEM116 may function as an oncogenic factor in lung cancer, promoting cellular behaviors associated with malignancy.

Despite these observations, it is worth noting that TMEM116 is not classified as a known cancer gene according to the Cancer Gene Census, and mouse insertional mutagenesis experiments do not support its designation as a cancer-causing gene . This suggests that the role of TMEM116 in cancer may be context-dependent or that it may contribute to cancer progression rather than initiation.

Association with Endometriosis

Beyond its implications in cancer, TMEM116 has also been associated with endometriosis of the pelvic peritoneum . The specific mechanisms underlying this association remain to be fully elucidated, but they may involve TMEM116's roles in cellular communication, proliferation, or inflammatory responses. Further research is needed to understand the precise contribution of TMEM116 to the development and progression of endometriosis.

Genetic Variations and Disease Susceptibility

Analysis of genetic data indicates that there are 95 unique samples with mutations in the TMEM116 gene out of 1019 samples analyzed . While the functional consequences of these mutations remain largely unexplored, they may contribute to altered TMEM116 function or expression in various disease contexts. Further investigation of these genetic variations could provide insights into the role of TMEM116 in disease susceptibility and progression.

Research Applications and Methods

Recombinant TMEM116 protein serves as a valuable tool for various research applications aimed at understanding the function and regulation of this protein in normal and pathological conditions.

Experimental Techniques and Applications

Several experimental techniques can be employed to study TMEM116, including:

  1. SDS-PAGE: For protein separation and analysis of purity and molecular weight .

  2. Western Blot (WB): For detection and quantification of TMEM116 protein in cell or tissue lysates .

  3. Enzyme-Linked Immunosorbent Assay (ELISA): For quantitative measurement of TMEM116 levels in various biological samples .

  4. Functional Assays: Including cell proliferation, migration, and invasion assays to assess the impact of TMEM116 modulation on cellular behaviors .

  5. Signaling Pathway Analysis: To investigate the interactions of TMEM116 with components of signaling cascades such as the PDK1-AKT-FOXO3A pathway .

Model Systems for TMEM116 Research

Various model systems can be used to study TMEM116 function, including:

  1. Cell Lines: Particularly cancer cell lines such as those derived from non-small-cell lung cancer, which exhibit high TMEM116 expression .

  2. Animal Models: Including mouse models for investigating the role of TMEM116 in tumor metastasis and other disease processes .

  3. Expression Systems: E. coli and wheat germ systems for the production of recombinant TMEM116 protein for in vitro studies .

These models and techniques provide complementary approaches for investigating the diverse aspects of TMEM116 biology and its implications in health and disease.

Current Challenges and Future Perspectives

Despite significant progress in understanding TMEM116, several challenges and opportunities for future research remain.

Knowledge Gaps and Research Limitations

Current knowledge of TMEM116 is limited by several factors, including:

  1. Structural Information: Detailed three-dimensional structural data for TMEM116 is lacking, which hampers understanding of its molecular mechanisms.

  2. Functional Characterization: The precise physiological functions of TMEM116 in normal tissues remain incompletely understood.

  3. Regulatory Mechanisms: The factors controlling TMEM116 expression and activity are not fully elucidated.

  4. Interaction Partners: The complete set of proteins and other molecules interacting with TMEM116 has not been comprehensively identified.

Emerging Research Directions

Future research on TMEM116 could focus on several promising directions:

  1. Structural Biology: Determination of the three-dimensional structure of TMEM116 to inform understanding of its function and potential as a therapeutic target.

  2. Systems Biology: Integration of TMEM116 into broader signaling networks and cellular processes.

  3. Therapeutic Targeting: Exploration of TMEM116 as a potential target for cancer therapy, particularly in non-small-cell lung cancer.

  4. Biomarker Development: Investigation of TMEM116 as a potential biomarker for cancer diagnosis, prognosis, or treatment response.

  5. Functional Genomics: Comprehensive analysis of the effects of TMEM116 genetic variations on protein function and disease susceptibility.

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format we currently have in stock. However, if you have a specific format requirement, kindly indicate it in your order remarks, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
TMEM116; Transmembrane protein 116
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-245
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
TMEM116
Target Protein Sequence
MKHTQSGQSTSPLVIDYTCRVCQMAFVFSSLIPLLLMTPVFCLGNTSECFQNFSQSHKCI LMHSPPSAMAELPPSANTSVCSTLYFYGIAIFLGSFVLSLLTIMVLLIRAQTLYKKFVKS TGFLGSEQWAVIHIVDQRVRFYPVAFFCCWGPAVILMIIKLTKPQDTKLHMALYVLQALT ATSQGLLNCGVYGWTQHKFHQLKQEARRDADTQTPLLCSQKRFYSRGLNSLESTLTFPAS TSTIF
Uniprot No.

Target Background

Database Links

HGNC: 25084

KEGG: hsa:89894

UniGene: Hs.506815

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure and basic characteristics of human TMEM116?

TMEM116 (Transmembrane Protein 116) is a membrane-spanning protein with a molecular weight of approximately 23 kDa . The full-length human TMEM116 protein consists of 245 amino acids . Structural analysis suggests it contains multiple transmembrane domains typical of integral membrane proteins. The protein sequence includes hydrophobic regions consistent with membrane-spanning segments that anchor the protein within cellular membranes.

For experimental applications, recombinant human TMEM116 can be expressed in wheat germ expression systems, yielding full-length protein (amino acids 1-245) suitable for various research applications . The protein contains specific motifs that suggest potential roles in ion transport across cellular membranes, though detailed structural studies using crystallography or cryo-EM remain limited in the current literature.

What cellular localization patterns does TMEM116 exhibit in human tissues?

TMEM116 displays distinct tissue-specific localization patterns that provide insights into its potential physiological functions. Immunohistochemical analyses reveal positive membranous staining in multiple human tissues:

  • Seminiferous duct cells in testis tissue

  • Glandular cells in gastrointestinal tissue

  • Glandular cells in stomach tissue

  • Glandular cells in fallopian tube tissue

At the subcellular level, immunofluorescence studies in the human A-431 cell line show that TMEM116 localizes predominantly to the nucleus but is notably absent from nucleoli. The protein does not appear to associate significantly with cytoskeletal elements such as microtubules . This nuclear localization is somewhat unexpected for a transmembrane protein and suggests potential multifunctional roles beyond typical membrane-associated functions.

When designing experiments to study TMEM116 localization, researchers should consider using multiple detection methods and cell types to comprehensively map its distribution patterns.

What are the optimal protocols for detecting and studying TMEM116 in experimental settings?

Several complementary approaches can be employed to study TMEM116, each with specific methodological considerations:

Immunohistochemistry (IHC-P):

  • Recommended antibody: Rabbit Polyclonal TMEM116 antibody (e.g., ab122663)

  • Optimal concentration: 1-4 μg/ml for tissue sections

  • Detection method: DAB or fluorescence-based visualization

  • Controls: Include negative controls (omitting primary antibody) and positive controls (tissues known to express TMEM116, such as testis or stomach)

Immunocytochemistry/Immunofluorescence (ICC/IF):

  • Cell preparation: Fixation with 4% paraformaldehyde followed by permeabilization

  • Antibody concentration: 1-4 μg/ml

  • Counterstaining: Consider DAPI for nuclear visualization to confirm nuclear localization

  • Imaging: Confocal microscopy recommended for precise subcellular localization

Western Blotting (WB):

  • Sample preparation: Ensure complete membrane protein extraction with appropriate detergents

  • Protein loading: 20-50 μg of total protein per lane

  • Recombinant protein controls: Consider using ab164800 as a positive control

  • Expected band size: Approximately 23 kDa

ELISA Applications:

  • Recombinant TMEM116 (ab164800) can be used for standard curve generation

  • Sensitivity optimization: Titrate antibody concentrations to determine optimal detection range

  • Sample types: Cell lysates, tissue homogenates, or serum depending on experimental question

How can researchers effectively express and purify recombinant TMEM116 for functional studies?

Producing recombinant TMEM116 requires careful consideration of expression systems and purification strategies:

Expression Systems Comparison:

Expression SystemAdvantagesLimitationsRecommended Applications
Wheat GermEukaryotic post-translational modifications, Good for membrane proteins, High solubilityLower yield than bacterial systems, Higher costStructural studies, Antibody production, Protein-protein interaction assays
E. coliHigh yield, Cost-effective, Rapid productionLimited post-translational modifications, Inclusion body formation commonBasic binding studies, Immunization, Epitope mapping
Mammalian CellsNative-like modifications, Proper foldingLower yield, Higher cost, Longer production timeFunctional assays, Cell-based screens, Protein-protein interactions

Purification Protocol Recommendations:

  • For wheat germ-expressed TMEM116 (as in ab164800) :

    • Cell lysis under non-denaturing conditions

    • Affinity chromatography using appropriate tags (His or GST)

    • Size exclusion chromatography for final purification

    • Buffer optimization to maintain membrane protein stability

    • Consider adding stabilizing agents like glycerol or specific detergents

  • Quality control measures:

    • SDS-PAGE with Coomassie staining to confirm size and purity

    • Western blot verification with anti-TMEM116 antibodies

    • Mass spectrometry for sequence confirmation

    • Functional assays to verify biological activity

What is currently known about the function of TMEM116 in cellular homeostasis?

Current evidence suggests TMEM116 plays roles in cellular ion transport and homeostasis, though detailed mechanistic studies remain limited . The protein's membrane-spanning domains are consistent with potential functions in:

  • Ion transport regulation: TMEM116 may facilitate the movement of specific ions across cellular membranes, contributing to electrochemical gradient maintenance . This hypothesis is supported by structural features including hydrophobic transmembrane segments consistent with ion channel components.

  • Cellular homeostasis maintenance: The expression pattern in secretory and absorptive tissues (stomach, intestine) suggests potential roles in maintaining cellular ionic balance . Researchers investigating this function should consider flux assays with ion-specific indicators or electrophysiological approaches.

  • Nuclear functions: The unexpected nuclear localization observed in some cell types suggests potential roles beyond typical membrane transport, possibly in signaling or regulatory pathways . This dual localization pattern warrants further investigation using cell fractionation studies combined with functional assays.

Methodological approaches to investigate these functions include:

  • Ion flux assays using fluorescent indicators

  • Patch-clamp electrophysiology

  • Knockout/knockdown studies followed by homeostasis challenge experiments

  • Protein-protein interaction screens to identify functional partners

How does TMEM116 interact with other proteins and cellular pathways?

While comprehensive interaction networks for TMEM116 remain to be fully characterized, correlation analyses from gene expression studies provide initial insights into potential functional associations :

Positive correlations have been observed between TMEM116 and several other membrane proteins, including:

  • TMEM97 (involved in cholesterol homeostasis)

  • TMEM17, TMEM22, TMEM48, TMEM158, TMEM206, and TMEM213

These correlations suggest potential functional relationships or co-regulation mechanisms that warrant further investigation through:

  • Co-immunoprecipitation followed by mass spectrometry to identify direct binding partners

  • Proximity labeling approaches (BioID or APEX) to map the protein's microenvironment

  • Co-expression studies using dual fluorescent reporters

  • Functional assays examining the impact of TMEM116 perturbation on associated proteins

Researchers investigating TMEM116 interactions should design experiments that can distinguish between direct physical interactions and indirect functional associations, possibly through a combination of in vitro binding assays and cellular co-localization studies.

What is the expression profile of TMEM116 in cancer and other pathological conditions?

TMEM116 shows altered expression in several pathological conditions, most notably in cancer:

Head and Neck Squamous Cell Carcinoma (HNSCC):

  • TMEM116 is significantly downregulated in HNSCC tumor samples compared to normal tissue

  • This downregulation pattern contrasts with some other TMEM family members (e.g., ANO1, TMEM17, TMEM48) that show upregulation in HNSCC

  • The expression changes appear to be tissue-specific and may vary based on tumor characteristics

Essential Hypertension:

  • Transcriptome-wide association studies have identified TMEM116 as a potential susceptibility gene for essential hypertension

  • The mechanistic link requires further investigation but may relate to TMEM116's potential role in ion transport

For researchers studying TMEM116 in disease contexts, methodological considerations should include:

  • Comparison of expression levels across multiple disease stages and subtypes

  • Correlation with clinical outcomes and treatment responses

  • Integration with other molecular markers for comprehensive profiling

  • Functional validation in disease-relevant cell or animal models

How can TMEM116 expression analysis be integrated into biomarker research?

While TMEM116 alone may not serve as a standalone biomarker, its integration into multi-gene panels shows promise for several applications:

Methodological approach for biomarker development:

  • Context-specific expression analysis:

    • Compare TMEM116 expression across normal, dysplastic, and malignant tissues

    • Stratify by relevant clinical factors (HPV status, tumor grade, anatomical site)

    • Correlate with treatment response and patient outcomes

  • Multi-gene panel integration:

    • Consider TMEM116 alongside other dysregulated TMEM family members

    • For HNSCC specifically, consider analyzing TMEM116 in conjunction with ANO1, TMEM156, TMEM173, and TMEM213, which have shown correlation with clinical status and immune responses

    • Develop weighted scoring algorithms that account for the relative contribution of each gene

  • Validation strategies:

    • Cross-platform validation (RNA-seq, qPCR, protein-level detection)

    • Independent cohort validation

    • Functional studies to establish biological relevance

Researchers should be cautious about technical variables that might affect TMEM116 detection and consider the biological context when interpreting expression changes.

How can TMEM116 be targeted for functional manipulation in experimental systems?

Advanced research on TMEM116 requires precise manipulation of its expression and function:

Gene Editing Approaches:

  • CRISPR-Cas9 knockout strategies:

    • Target early exons to ensure complete loss of function

    • Design multiple guide RNAs to increase efficiency

    • Include rescue experiments with recombinant protein to confirm specificity

  • Knockin modifications:

    • Consider epitope tagging at N- or C-terminus for improved detection

    • Introduce point mutations to study specific functional domains

    • Create conditional alleles for tissue-specific manipulation

RNA Interference:

  • siRNA targeting specific TMEM116 regions

  • shRNA for stable knockdown studies

  • Antisense oligonucleotides for in vivo applications

Overexpression Systems:

  • Inducible expression systems to control timing and level

  • Viral vectors for efficient delivery to difficult-to-transfect cells

  • Domain-specific constructs to dissect protein function

Functional Modulation:

  • Small molecule screening to identify potential inhibitors or activators

  • Antibody-based functional blocking approaches

  • Peptide mimetics targeting specific protein interfaces

For each approach, careful validation of manipulation efficiency and specificity is essential through:

  • qPCR and western blot confirmation

  • Phenotypic characterization

  • Off-target effect assessment

  • Dose-response relationships

What are the most promising future research directions for TMEM116?

Based on current knowledge gaps and preliminary findings, several research directions show particular promise:

  • Structural biology approaches:

    • Cryo-EM or X-ray crystallography to resolve TMEM116 structure

    • Molecular dynamics simulations to understand conformational changes

    • Structure-guided functional domain mapping

  • Systems biology integration:

    • Multi-omics approaches combining transcriptomics, proteomics, and metabolomics

    • Network analysis to position TMEM116 within broader cellular pathways

    • Machine learning applications to predict functional associations

  • Translational research avenues:

    • Development of TMEM116-targeted therapeutics for relevant pathologies

    • Biomarker validation in larger clinical cohorts

    • Patient-derived models to study personalized responses

  • Evolutionary biology perspectives:

    • Comparative analysis across species to identify conserved functions

    • Adaptive evolution studies to understand specialized roles

    • Paralog functional divergence investigation

  • Technological innovations:

    • Development of specific tools for TMEM116 detection and manipulation

    • High-throughput screening approaches to identify interactors

    • Advanced imaging techniques to track dynamics in living cells

Researchers pursuing these directions should emphasize interdisciplinary approaches and consider both basic mechanistic studies and potential clinical applications.

What are the common challenges in TMEM116 research and how can they be addressed?

Researching transmembrane proteins like TMEM116 presents several technical challenges:

Challenge: Antibody specificity and validation

  • Solution: Utilize multiple antibodies targeting different epitopes

  • Implementation: Compare staining patterns across antibodies and validate with knockout controls

  • Methodological check: Preabsorption with recombinant TMEM116 protein to confirm specificity

Challenge: Protein solubilization and extraction

  • Solution: Optimize detergent conditions specifically for TMEM116

  • Implementation: Test panel of detergents (CHAPS, DDM, Triton X-100) at various concentrations

  • Methodological check: Western blot to confirm extraction efficiency

Challenge: Distinguishing membrane vs. nuclear pools

  • Solution: Rigorous subcellular fractionation

  • Implementation: Differential centrifugation with marker verification

  • Methodological check: Immunofluorescence correlation with biochemical fractionation

Challenge: Functional assay development

  • Solution: Establish clear readouts based on hypothesized functions

  • Implementation: Ion flux assays, interaction screens, or phenotypic analyses

  • Methodological check: Include positive controls with known membrane transporters

Challenge: Low expression levels in some systems

  • Solution: Enrichment strategies and sensitive detection methods

  • Implementation: Consider immunoprecipitation before analysis

  • Methodological check: qPCR validation of expression levels

How should researchers interpret contradictory findings about TMEM116 in the literature?

When facing conflicting reports about TMEM116 function or expression, researchers should consider:

  • Methodological differences assessment:

    • Compare detection methods (antibody-based vs. transcript-based)

    • Evaluate sample processing protocols

    • Consider quantification and normalization approaches

  • Biological context variables:

    • Cell/tissue type specificity

    • Disease state and progression stage

    • Microenvironmental conditions

    • Species differences if comparing across organisms

  • Technical resolution approach:

    • Direct side-by-side comparison using standardized protocols

    • Utilization of multiple complementary techniques

    • Collaboration with groups reporting conflicting results

  • Interpretation framework:

    • Consider TMEM116 might have context-dependent functions

    • Look for conditional factors that might explain differences

    • Develop testable hypotheses that could reconcile contradictions

Researchers should approach contradictions as opportunities to discover new regulatory mechanisms or context-dependent functions, rather than simply dismissing conflicting reports.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.