Recombinant Human Transmembrane protein 121 (TMEM121)

Shipped with Ice Packs
In Stock

Description

Anti-Proliferative Effects in Cervical Cancer

  • Overexpression studies in HeLa cells showed:

    • Reduced cell viability (CCK-8 assay: 24–72 hr post-transfection)

    • Inhibition of migration (scratch assay: 48 hr wound closure rate ↓40%)

    • Downregulation of BCL-2, cyclin D1, cyclin E2, and p-AKT

ParameterTMEM121 OverexpressionTMEM121 Knockdown
Cell viability (72 hr)↓35%
Scratch healing rate↓50%
p-p38 expression↑2.1-fold↓1.8-fold

Pro-Proliferative Role in Adrenocortical Cells

  • Transfection of TMEM121 into rat adrenocortical progenitor cells increased:

    • Ki67 expression: 3.2-fold at 48 hr (P<0.05)

    • PCNA expression: 1.8-fold at 96 hr (P<0.05)

Pathway Interactions

TMEM121 modulates multiple oncogenic pathways:

  • PI3K/AKT: Correlates negatively with PIK3CB (r=−0.62) and CASP3 (r=−0.58) in cervical cancer .

  • MAPK: Upregulates p-p38 during overexpression, enhancing pro-apoptotic signaling .

  • Cell Cycle Regulation: Suppresses cyclin D1/E2 and upregulates p27, inducing G1/S arrest .

Epigenetic and Environmental Modulators

Gene-chemical interaction studies reveal:

  • Downregulation by benzo[a]pyrene, copper sulfate, and cyclosporin A .

  • Methylation: Promoter hypermethylation observed in cervical tumors, correlating with reduced expression .

Therapeutic Implications

  • Diagnostic Potential: TMEM121 promoter methylation status could serve as a biomarker for cervical squamous cell carcinoma (CESC) .

  • Therapeutic Target: Restoring TMEM121 expression via gene therapy inhibits cervical cancer progression in vitro , while its suppression may benefit adrenocortical hyperplasia .

Research Gaps and Future Directions

  • No in vivo studies on recombinant TMEM121 delivery.

  • Mechanistic links between TMEM121 and the TGF-β/JAK-STAT pathways require validation.

  • Species-specific differences in TMEM121 function (e.g., anti-cancer in humans vs. pro-proliferative in rats) need resolution .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a particular tag, please specify this in your order; we will prioritize its development.
Synonyms
TMEM121; HHOLE; Transmembrane protein 121
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-319
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
TMEM121
Target Protein Sequence
MVLPPPDRRHVCLTTLVIMGSMAVMDAYLVEQNQGPRKIGVCIIVLVGDVCFLLVLRYVA VWVGAEVRTAKRGYAMILWFLYIFVLEIKLYFIFQNYKAARRGAADPVARKALTLLLSVC VPGLFLLLVALDRMEYVRTFRKREDLRGRLFWVALDLLDLLDMQASLWEPPRSGLPLWAE GLTFFYCYMLLLVLPCVALSEVSMQGEHIAPQKMMLYPVLSLATVNVVAVLARAANMALF RDSRVSAIFVGKNVVALATKACTFLEYRRQVRDFPPPALSLELQPPPPQRNSVPPPPPPL HGPPGRPHMSSPTRDPLDT
Uniprot No.

Target Background

Function
Plays a potential role in MAPK signaling pathways.
Gene References Into Functions
  1. HHole as a novel repressor of cardiac hypertrophy. PMID: 27211802
  2. An insertion-deletion (GCC/-) polymorphism (SNP rs10569304) has been identified in Southern Chinese populations. Individuals with the BB genotype exhibit a higher risk of congenital heart disease. PMID: 20714865
Database Links

HGNC: 20511

KEGG: hsa:80757

STRING: 9606.ENSP00000376304

UniGene: Hs.157527

Protein Families
TMEM121 family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Highly expressed in heart and detected in pancreas, liver and skeletal muscle.

Q&A

What is the molecular structure of human TMEM121?

Human TMEM121 is a 319-amino acid, six-transmembrane protein featuring a proline-rich C-terminal motif and an N-terminal extracellular signal-regulated kinase binding domain (D-domain) that shows high conservation across species evolution . This protein was originally isolated from chicken heart using subtraction hybridization techniques . The conserved D-domain suggests potential interactions with signaling pathways, while the proline-rich C-terminal likely mediates protein-protein interactions. Researchers working with recombinant TMEM121 should pay particular attention to preserving these domains to maintain proper protein folding and function in experimental systems.

What is currently known about the tissue expression pattern of TMEM121?

TMEM121 shows differential expression across various tissues, with significant expression in specific regions:

  • Cardiac tissue: TMEM121 is highly expressed in adult mouse hearts, where it appears to function as an inhibitor of pathological cardiac hypertrophy .

  • Adrenal glands: Histological studies have demonstrated high TMEM121 expression in the capsule and sub-capsular areas of the adrenal cortex, particularly in regions associated with stem/progenitor cell populations .

  • Cancer tissues: TMEM121 shows significantly reduced expression in cervical squamous cell carcinoma and endocervical adenocarcinoma (CESC) compared to normal tissues, as well as downregulation in kidney chromophobe, kidney renal papillary cell carcinoma, liver hepatocellular carcinoma, and uterine corpus endometrial carcinoma .

When studying TMEM121 expression patterns, researchers should use multiple detection methods (RT-PCR, Western blot, immunohistochemistry) to confirm expression in their tissue of interest.

What are the recommended methods for cloning and expressing recombinant human TMEM121?

For successful cloning of the full-length TMEM121 gene, researchers should follow these methodological steps:

  • Primer design: Target the complete coding sequence with specific primers. For transcript variant X1 (accession number XM_006225896.3), successful amplification has been achieved with:

    • Forward primer: 5'-GCAGGACCTCGTCCCGCTTT-3' (position 194-217)

    • Reverse primer: 5'-TAGTCCAGCGTCTGTGCGGC-3' (position 1252-1233)

  • PCR conditions: Use a high-fidelity polymerase with the following optimized protocol:

    • Initial denaturation: 94°C for 1 minute

    • 36 cycles of: 94°C for 20 seconds, 59°C for 20 seconds, 72°C for 3 minutes

    • Final extension at 72°C

  • Expression vector selection:

    • For mammalian expression: pCMV-Tag2B (shown effective for TMEM121 overexpression studies)

    • For co-expression studies: pIRES2-ERFP (successful for adrenocortical cell studies)

  • Restriction site addition: For directional cloning, add appropriate restriction sites to primers, such as EcoR1 (5'-GAATTC-3') for forward primers and HindIII (5'-AAGCTT-3') for reverse primers, ensuring these sites don't exist within the TMEM121 sequence .

  • Purification and verification: After amplification, purify the PCR product using gel extraction and verify the insert by sequencing before expression studies.

How can successful TMEM121 overexpression or knockdown be verified in experimental models?

To confirm successful manipulation of TMEM121 expression:

For overexpression verification:

  • Western blot analysis: Using specific anti-TMEM121 antibodies, compare protein levels between transfected cells and control cells (empty vector transfection). Studies have demonstrated clear increased TMEM121 protein expression following pCMV-Tag2B-TMEM121 transfection in HeLa cells .

  • Immunocytofluorescence: This technique has successfully confirmed TMEM121 overexpression in transfected adrenocortical stem/progenitor cells and provides information about subcellular localization .

For knockdown verification:

  • Western blot analysis: Confirm reduced protein expression compared to controls transfected with non-targeting vectors. Previous studies have successfully demonstrated TMEM121 protein expression reduction using pSUPER-TMEM121 for RNA interference in HeLa cells .

  • Functional assays: Perform phenotypic analyses to confirm biological effects. For TMEM121, these should include:

    • Proliferation assays (CCK-8)

    • Migration assays (cell scratch experiments)

    • Western blot analysis of downstream effector proteins

For both approaches, extract proteins 48 hours post-transfection for optimal detection of expression changes .

What is the role of TMEM121 in cancer biology, particularly in cervical cancer?

TMEM121 appears to function as a tumor suppressor in cervical cancer, with multiple lines of evidence supporting this role:

  • Expression analysis: TMEM121 is significantly downregulated in cervical squamous cell carcinoma and endocervical adenocarcinoma (CESC) compared to normal tissues, as demonstrated through TIMER and UALCAN bioinformatics analyses .

  • Epigenetic regulation: The methylation level of the TMEM121 gene promoter is increased in CESC tumor tissues compared to normal tissues, suggesting epigenetic silencing of this gene contributes to cancer development .

  • Functional studies in cancer cells:

    • Cell viability: TMEM121 overexpression significantly reduces HeLa cell viability at 24, 48, and 72 hours post-transfection in CCK-8 assays, indicating inhibition of cell proliferation .

    • Cell migration: Cell scratch assays demonstrate that TMEM121 overexpression significantly decreases the migratory ability of HeLa cells at 24 and 48 hours .

  • Molecular mechanism: TMEM121 influences multiple cancer-related proteins:

    • Downregulates anti-apoptotic protein BCL-2

    • Reduces expression of cell cycle promoters cyclin D1 and cyclin E2

    • Decreases phosphorylated AKT (p-AKT)

    • Increases tumor suppressor p27

    • Enhances expression of E-cadherin, which promotes cell adhesion and reduces invasiveness

When designing experiments to investigate TMEM121's role in cancer, researchers should include both gain-of-function (overexpression) and loss-of-function (knockdown) approaches to comprehensively assess its effects.

How does TMEM121 interact with the PI3K/AKT signaling pathway in cancer cells?

TMEM121 demonstrates significant interactions with the PI3K/AKT pathway, a central regulator of cell survival and proliferation:

  • Correlation analysis: Using the cBioPortal platform, researchers identified significant correlations between TMEM121 expression and key PI3K/AKT pathway components in cervical cancer:

    • Positive correlation with AKT1 expression

    • Negative correlation with PIK3CB, CASP3, and CDH1 expression

  • Western blot analysis of pathway components following TMEM121 modulation:

ProteinEffect of TMEM121 overexpressionEffect of TMEM121 knockdown
p-AKTDecreasedNot reported
BCL-2DecreasedNot reported
p27IncreasedDecreased
E-cadherinIncreasedDecreased
p-p38IncreasedDecreased
p-JNKNot reportedDecreased
RBNot reportedDecreased
p53Not reportedDecreased

These protein changes indicate that TMEM121 suppresses the PI3K/AKT pathway, potentially explaining its anti-proliferative and anti-migratory effects in cervical cancer cells .

For researchers investigating this interaction, measuring phosphorylation status of AKT and its downstream targets is essential, as this reflects pathway activity more accurately than total protein levels.

What methodologies are most effective for studying TMEM121's effects on cell proliferation and migration?

Based on published research, the following methodologies have proven effective for studying TMEM121's cellular effects:

For proliferation assessment:

  • Cell Counting Kit-8 (CCK-8) assay: This method successfully demonstrated reduced cell viability in HeLa cells with TMEM121 overexpression at 24, 48, and 72 hours post-transfection .

    • Recommended cell density: 5×10³ cells per well in 96-well plates

    • Measurement timepoints: 24, 48, and 72 hours post-transfection

    • Include proper controls: empty vector-transfected cells

  • Western blot analysis of proliferation markers:

    • Cyclins (D1, E1, E2): TMEM121 overexpression downregulates cyclins D1 and E2

    • CDK inhibitors (p27): TMEM121 overexpression upregulates p27

    • Tumor suppressors (p53, RB): TMEM121 knockdown decreases these proteins

For migration assessment:

  • Cell scratch assay (wound healing assay):

    • Create a uniform scratch in confluent cell monolayers

    • Image wound closure at 24, 48, and 72 hours

    • Calculate wound closure rates as a percentage of the initial wound area

    • TMEM121 overexpression significantly decreased migration at 24 and 48 hours in HeLa cells

  • Analysis of migration-related proteins:

    • E-cadherin: TMEM121 overexpression increases E-cadherin, promoting cell-cell adhesion and reducing migratory capacity

For both assessments, time course experiments (24, 48, and 72 hours) are critical to capture both immediate and delayed effects of TMEM121 modulation.

What role does TMEM121 play in adrenocortical stem/progenitor cell biology?

TMEM121 appears to have a distinct role in adrenocortical stem/progenitor cells compared to cancer cells:

  • Expression pattern: Histological studies have demonstrated high expression of TMEM121 in the capsule and sub-capsular areas of the adrenal cortex, regions known to harbor stem/progenitor cells with limited steroidogenic capacity .

  • Co-localization with proliferation markers: TMEM121 shows high co-localization with Ki67 in the sub-capsular area, suggesting association with proliferating cells .

  • Functional effects on proliferation:

    • When TMEM121 is transfected into isolated adrenocortical stem/progenitor cells, it produces a significant increase in proliferation markers

    • Real-time PCR analysis shows upregulation of both Ki67 and proliferating cell nuclear antigen (PCNA) following TMEM121 overexpression

This represents an interesting contrast to TMEM121's effects in cervical cancer cells, where it inhibits proliferation. This dichotomy suggests that TMEM121's function may be cell type-specific and dependent on the cellular context.

For researchers studying adrenocortical biology, these findings position TMEM121 as a potential regulatory factor in stem/progenitor cell maintenance and proliferation. The methodology for studying this role includes:

  • Isolation and in vitro cultivation of adrenocortical stem/progenitor cells

  • Transfection with TMEM121 expression vectors

  • Assessment of proliferation marker expression using real-time PCR and immunocytofluorescence

  • Correlation of TMEM121 expression with stem/progenitor cell functions

How can contradictory data regarding TMEM121's role in different cell types be reconciled?

The available research presents an interesting dichotomy in TMEM121's function: it appears to inhibit proliferation and migration in cervical cancer cells while promoting proliferation in adrenocortical stem/progenitor cells . Reconciling these apparently contradictory roles requires consideration of several factors:

  • Cell context dependency: TMEM121 may interact with different signaling networks in different cell types, leading to context-dependent functions. Methodology to investigate this includes:

    • Comparative protein-protein interaction studies across cell types

    • Pathway analysis in both contexts to identify differential signaling partners

    • Transcriptome profiling following TMEM121 modulation in both cell types

  • Differentiation state effects: TMEM121 may have opposite effects depending on the cell's differentiation status:

    • In adrenocortical stem/progenitor cells: promotes proliferation to maintain the stem cell pool

    • In cervical cancer cells: potentially promotes differentiation and inhibits the cancer stem cell phenotype

  • Signaling pathway integration:

    • In cervical cancer cells: TMEM121 inhibits the PI3K/AKT pathway, reducing proliferation and migration

    • In adrenocortical stem cells: TMEM121 may activate alternative pathways that override AKT inhibition or engage with different downstream effectors

To systematically resolve these contradictions, researchers should:

  • Use identical experimental approaches in both cell types

  • Conduct comprehensive signaling pathway analysis

  • Investigate whether different TMEM121 isoforms or post-translational modifications exist in different tissues

  • Perform domain deletion studies to identify which regions mediate cell type-specific effects

What are the optimal experimental designs for functional domain analysis of TMEM121?

To systematically analyze TMEM121's functional domains and their contributions to its biological activities:

  • Domain deletion analysis:

    • Create a panel of constructs with sequential deletions of:

      • N-terminal D-domain (potential ERK interaction site)

      • Individual transmembrane domains

      • Proline-rich C-terminal motif

    • Express these in appropriate cell models and assess:

      • Subcellular localization

      • Effects on proliferation (CCK-8 assay)

      • Effects on migration (scratch assay)

      • PI3K/AKT pathway modulation (Western blot for p-AKT)

  • Site-directed mutagenesis:

    • Target conserved residues in each domain, particularly the D-domain

    • Assess functional consequences on the same parameters listed above

    • Focus on proline residues in the C-terminal motif, as these often mediate protein-protein interactions

  • Protein-protein interaction mapping:

    • Use co-immunoprecipitation to identify TMEM121 binding partners

    • Map interactions to specific domains using the deletion constructs

    • Validate key interactions with proximity ligation assays in intact cells

  • Rescue experiments:

    • In TMEM121 knockdown cells, re-express domain mutants to identify which domains are essential for:

      • Inhibition of cell proliferation in cancer cells

      • Regulation of migration

      • Modulation of PI3K/AKT signaling components

  • Comparative analysis across cell types:

    • Test identical domain mutants in both cancer cells and adrenocortical stem/progenitor cells

    • Identify domains responsible for cell type-specific effects

This systematic approach will help elucidate the structure-function relationship of TMEM121 and potentially explain its differential effects across cell types.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.