Recombinant Human Transmembrane protein 126B (TMEM126B)

What is TMEM126B and what is its fundamental role in mitochondrial function?

TMEM126B is a mitochondrial transmembrane protein encoded by the TMEM126B gene located on chromosome 11q14.1. It serves as an essential assembly factor required specifically for the formation of the membrane arm of mitochondrial complex I, the first enzyme in the respiratory chain . The protein functions within the mitochondrial complex I assembly (MCIA) complex, alongside other assembly factors including NDUFAF1, ECSIT, and ACAD9 . Without TMEM126B, these assembly factors cannot be properly recruited into the mitochondrial membrane, leading to severe impairment of complex I assembly and consequently, mitochondrial respiration .

What is the molecular structure of human TMEM126B?

Human TMEM126B is a 21.5 kDa protein comprised of 195 amino acids. The TMEM126B gene contains 7 exons and produces a protein with multiple predicted transmembrane domains . The full-length protein sequence is:

MAASMHGQPSPSLEDAKLRRPMVIEIIEKNFDYLRKEMTQNIYQMATFGTTAGFSGIFSN FLFRRCFKVKHDALKTYASLATLPFLSTVVTDKLFVIDSLYSDNISKENCVFRSSLIGIV CGVFYPSSLAFTKNGRLATKYHTV-PLPPKGRVLIHWMTLCQTQMKLMAIPLVFQIMFGIL NGLYHYAVFEETLEKTIHEEA

Current structural predictions suggest an L-shaped configuration when assembled within complex I, with hydrophobic regions embedded in the inner mitochondrial membrane .

How is TMEM126B expression distributed across different tissues?

TMEM126B demonstrates broad tissue distribution but with notable expression patterns. It is expressed in most human tissues with particularly high expression observed in parathyroid, bone marrow, and urinary bladder tissues . Interestingly, TMEM126B expression is notably absent or minimal in adipose tissue, ear tissue, larynx, lymph tissue, nerve tissue, pituitary gland, spleen, thymus, thyroid, trachea, and umbilical cord . Some isoforms of TMEM126B have been detected in the cell membrane of memory B cells, suggesting potential functions beyond mitochondria .

What expression systems are most effective for producing recombinant TMEM126B?

For recombinant TMEM126B production, wheat germ cell-free expression systems have demonstrated considerable success, particularly for obtaining the N-terminal portion (amino acids 1-200) . This approach overcomes some of the challenges associated with expressing transmembrane proteins in bacterial systems. When using wheat germ expression systems:

• Optimize codon usage for plant expression

• Include appropriate purification tags (GST-tag has proven effective)

• Ensure proper buffer conditions (50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0)

Alternative expression systems include mammalian cell lines for full-length protein expression, which may better preserve native post-translational modifications.

What purification techniques yield highest quality recombinant TMEM126B?

Affinity chromatography using GST-tag systems has proven effective for recombinant TMEM126B purification . The purification protocol should include:

• Cell lysis under non-denaturing conditions

• Binding to glutathione resin

• Thorough washing to remove non-specific binding

• Elution with reduced glutathione (10 mM)

• Quality control via SDS-PAGE (12.5%) with Coomassie staining

For structural studies requiring higher purity, consider additional size-exclusion chromatography steps to remove aggregates and degradation products.

What experimental applications are appropriate for recombinant TMEM126B proteins?

Recombinant TMEM126B proteins are valuable tools for multiple experimental applications:

• Antibody generation and validation: GST-tagged recombinant TMEM126B serves as an excellent immunogen or control antigen for western blotting

• Protein-protein interaction studies: Pull-down assays using tagged TMEM126B to identify binding partners in the MCIA complex

• Structural studies: Providing purified protein for crystallography or cryo-EM analysis

• In vitro assembly assays: Reconstituting complex I assembly with purified components

• Antibody microarrays: For high-throughput studies of TMEM126B interactions

What is the specific role of TMEM126B in mitochondrial complex I assembly?

TMEM126B functions specifically in the assembly of the ND2-module of complex I, which is essential for the formation of the membrane arm . The assembly process follows a defined sequence:

• TMEM126B associates with the intermediate 370 kDa subcomplex of incompletely assembled complex I

• It facilitates the recruitment of other assembly factors (NDUFAF1, ECSIT, ACAD9) to the inner mitochondrial membrane

• These factors collectively enable the proper incorporation of membrane-embedded subunits

• Upon successful assembly, TMEM126B is not retained in the mature complex I

This process is distinct from that of its paralogue TMEM126A, which is involved in the assembly of the ND4 distal membrane module of complex I .

How does TMEM126B interact with other components of the MCIA complex?

TMEM126B functions within the MCIA complex through specific protein-protein interactions:

These interactions are essential for the stepwise assembly of complex I, which follows a modular pattern with TMEM126B specifically mediating the integration of the membrane arm .

What distinguishes TMEM126B function from its paralogue TMEM126A?

Despite structural similarities, TMEM126B and TMEM126A perform distinct functions in complex I assembly:

The functional specialization of these paralogues demonstrates the intricate regulation of complex I assembly, with each protein mediating distinct steps in the process .

What types of mutations in TMEM126B are associated with mitochondrial diseases?

Several pathogenic variants in TMEM126B have been identified with distinct molecular consequences:

• Splicing mutations: The intronic mutation c.82-2 A>G causes complete exon 2 skipping

• Insertions/Duplications: The c.290dupT mutation leads to partial and complete exon 3 skipping

• Missense mutations: Affect protein stability or interaction capability

• Frameshift mutations: Result in premature termination codons and truncated proteins

These mutations typically lead to translational frameshifts and premature termination, resulting in non-functional TMEM126B protein .

What clinical phenotypes are associated with TMEM126B deficiency?

TMEM126B mutations manifest as a spectrum of clinical presentations:

• Classical presentation: Exercise intolerance, muscle weakness, and hyperlactic acidemia

• Systemic involvement: Hypertrophic cardiomyopathy and renal tubular acidosis

• Neurological phenotypes: Recently, a novel association with Leigh-like syndrome has been reported in a Chinese patient with biallelic TMEM126B mutations

• Severity spectrum: Ranges from childhood-onset severe multi-system disorders to adult-onset myopathy

Notably, most patients with TMEM126B mutations retain normal neurological function, making the recent association with Leigh-like syndrome a significant expansion of the clinical spectrum .

How can researchers model TMEM126B deficiency for pathophysiological studies?

Several experimental approaches have proven valuable for studying TMEM126B deficiency:

• Patient-derived lymphocytes/fibroblasts: Direct investigation of pathogenic mutations in patient cells, allowing analysis of complex I assembly and function

• CRISPR-Cas9 gene editing: Generation of cell lines with specific TMEM126B mutations

• Minigene splicing assays: Particularly useful for investigating the effects of intronic mutations on splicing patterns

• RNA analysis: Assessment of aberrant splicing events and nonsense-mediated decay

• Blue-native PAGE: Visualization of complex I assembly intermediates in deficient cells

These complementary approaches provide insights into both molecular mechanisms and functional consequences of TMEM126B deficiency.

What are optimal approaches for studying TMEM126B protein-protein interactions?

Advanced methodologies for investigating TMEM126B interactions include:

• BioID proximity labeling: Fusion of TMEM126B with a biotin ligase to identify proximal proteins in the native cellular environment

• Pulse-labeling interaction studies: Particularly effective for detecting interactions with newly synthesized mtDNA-encoded subunits, similar to approaches used for TMEM126A

• Quantitative proteomics: SILAC or TMT labeling coupled with mass spectrometry to identify differential protein associations upon TMEM126B depletion

• Co-immunoprecipitation with crosslinking: Essential for capturing transient interactions during the dynamic assembly process

• Blue-native PAGE combined with second-dimension SDS-PAGE: For resolution of TMEM126B-containing complexes and subcomplexes

These techniques have revealed that TMEM126B associates specifically with the intermediate 370 kDa subcomplex during complex I assembly .

How can researchers assess the functional consequences of TMEM126B variants?

Functional characterization of TMEM126B variants requires multi-dimensional assessment:

• Complex I enzymatic activity: Measuring NADH:ubiquinone oxidoreductase activity in isolated mitochondria

• Oxygen consumption measurements: Using Seahorse XF analyzers to assess mitochondrial respiration in intact cells

• Supercomplex assembly analysis: Blue-native PAGE to evaluate the integration of complex I into respiratory supercomplexes

• In silico prediction tools: For initial assessment of variant pathogenicity (particularly for splicing mutations)

• Minigene splicing assays: Experimental validation of predicted splicing defects for intronic variants

This multilevel approach provides comprehensive insights into how specific variants affect TMEM126B function and mitochondrial respiration.

What cutting-edge techniques are advancing our understanding of TMEM126B topology and structure?

Several emerging techniques are enhancing our structural understanding of TMEM126B:

• Cryo-electron microscopy: Applied to purified MCIA complexes to determine the structural organization of TMEM126B within its native complex

• Hydrogen-deuterium exchange mass spectrometry: For mapping protein interaction surfaces and conformational dynamics

• Single-particle electron microscopy: To visualize assembly intermediates containing TMEM126B

• Integrative structural biology approaches: Combining crystallography, NMR, and computational modeling

• Membrane protein topology mapping: Using site-specific labeling and protease accessibility assays

These techniques are particularly challenging for transmembrane proteins like TMEM126B but are essential for understanding its precise structural arrangement and mechanism of action.