Recombinant Human Transmembrane protein 129 (TMEM129)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
TMEM129; E3 ubiquitin-protein ligase TM129; RING-type E3 ubiquitin transferase TM129
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
29-362
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
TMEM129
Target Protein Sequence
AGLTVQNLLSGWLGSEDAAFVPFHLRRTAATLLCHSLLPLGYYVGMCLAASEKRLHALSQ
APEAWRLFLLLAVTLPSIACILIYYWSRDRWACHPLARTLALYALPQSGWQAVASSVNTE
FRRIDKFATGAPGARVIVTDTWVMKVTTYRVHVAQQQDVHLTVTESRQHELSPDSNLPVQ
LLTIRVASTNPAVQAFDIWLNSTEYGELCEKLRAPIRRAAHVVIHQSLGDLFLETFASLV
EVNPAYSVPSSQELEACIGCMQTRASVKLVKTCQEAATGECQQCYCRPMWCLTCMGKWFA
SRQDPLRPDTWLASRVPCPTCRARFCILDVCTVR
Uniprot No.
Target Background
Function
TMEM129 is an E3 ubiquitin-protein ligase involved in endoplasmic reticulum-associated protein degradation. It preferentially interacts with the E2 enzyme UBE2J2 and is exploited by viral US11 proteins to mediate the degradation of HLA class I proteins.
Gene References Into Functions
- The C-terminal RING domain of TMEM129, positioned in the cytosol via its ER membrane insertion, catalyzes ubiquitination reactions essential for the cytosolic degradation of secretory proteins. PMID: 27854284
- TRC8 and TMEM129 function as ER-associated degradation ubiquitin E3 ligases, targeting both viral and cellular MHC class I proteins. (Review) PMID: 26210183
- TMEM129 is integral to the ER-resident dislocation complex mediating US11-induced HLA class I degradation. PMID: 24807418
Database Links
Protein Families
TMEM129 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
