Recombinant Human Transmembrane protein 133 (TMEM133)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-129
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
TMEM133
Target Protein Sequence
MTSHHCVGPGNHISWSGHEKEHRLDYCPEVTFPLTKGFPLGYTLLFNFASYPFLLPSKIK TLLRNKDSFLNILCPACLLLIRRCNIEYSSTGLNFLNTFTVSLIVTVIPLLQNVPVPLGN NVGKMQVYE
Uniprot No.

Q&A

What is the basic function and biological role of TMEM133?

TMEM133 is a transmembrane protein that plays crucial roles in regulating cellular processes, including ion transport, cell migration, and synaptic plasticity . Recent research has identified TMEM133 as a DNA damage response gene that can induce apoptosis through the upregulation of G2/M cell cycle arrest-related genes . Its activation appears essential for the inhibition of tumor cell growth, particularly when cells are treated with specific compounds such as triazole/thiadiazole substituted 4'-demethylepipodophyllotoxin derivatives .

Methodological approach: To investigate TMEM133 function, researchers typically employ gene knockdown (siRNA/shRNA) and overexpression systems in appropriate cell lines, followed by functional assays measuring:

  • Cell cycle progression via flow cytometry

  • Apoptotic markers (caspase activity, Annexin V staining)

  • DNA damage response (γH2AX foci formation, comet assay)

  • Cell migration (wound healing, transwell assays)

What disease associations have been identified for TMEM133?

Mutations in the tmem133 gene have been linked to several neurological conditions, including:

Neurological ConditionPrevalence in TMEM133 Mutation CarriersPrimary Symptoms
Spinocerebellar ataxia type 31 (SCA31)Primary associationProgressive difficulty with coordination, balance, and speech
Episodic ataxia type 2 (EA2)Secondary associationSudden, transient episodes of incoordination and slurred speech
DYT32 dystoniaRare associationAbnormal muscle contractions and movement disorders
Intellectual disabilityAssociated with SCA31 casesCognitive impairment

Approximately 0.5% of individuals with neurodegenerative diseases carry mutations in the tmem133 gene, highlighting its potential significance in neurological health .

Where is TMEM133 predominantly expressed in human tissues?

While specific TMEM133 expression data is limited, the protein appears to be expressed across multiple tissues. Studies on related transmembrane proteins (such as TMEM132A) show expression patterns in:

  • Neural tissues (cerebral cortex, amygdala, cerebellum)

  • Epithelial tissues (stomach, salivary gland)

  • Endocrine tissues (pituitary, ovaries)

  • Other organs (kidneys, lungs)

For experimental validation of expression patterns, researchers should consider:

  • RT-qPCR analysis of tissue panels

  • Western blotting using validated anti-TMEM133 antibodies

  • Immunohistochemistry of tissue microarrays

  • Single-cell RNA sequencing data analysis

What expression systems are most effective for producing recombinant TMEM133?

Based on general principles for transmembrane protein expression and limited data on TMEM family proteins:

Expression SystemAdvantagesLimitationsYield Expectations
E. coliCost-effective, rapid growth, established protocolsOften forms inclusion bodies, lacks mammalian PTMsLow-moderate; requires optimization
Mammalian cells (HEK293, CHO)Native folding, proper PTMs, functional proteinHigher cost, slower growth, lower yieldsModerate; 1-5 mg/L culture
Insect cells (Sf9, Hi5)Better folding than E. coli, moderate PTMsMedium cost, requires viral transductionModerate-high; 5-10 mg/L culture

For challenging transmembrane proteins like TMEM133, mammalian expression systems often provide the best balance of protein quality and yield. Using the rhamnose promoter-based expression system in E. coli could be beneficial if bacterial expression is preferred .

What are the key considerations for designing a TMEM133 expression construct?

When designing an expression construct for TMEM133:

  • Signal peptide selection: Test multiple signal peptides (e.g., DsbA, OmpA, PhoA, Hbp) as their efficiency can significantly impact translocation and proper folding .

  • Fusion tags to consider:

    • N-terminal: Avoid disrupting signal peptide function

    • C-terminal: His6 tag for purification

    • TEV protease cleavage site between protein and tag

    • Consider testing both N- and C-terminal tag positions

  • Codon optimization:

    • Optimize codons for the selected expression system

    • Avoid rare codons in the expression host

    • Consider GC content and mRNA secondary structures

  • Promoter selection:

    • For mammalian expression: CMV promoter

    • For bacterial expression: Rhamnose-inducible promoter allows titration of expression levels

    • For insect cells: Polyhedrin or p10 promoters

What purification strategies are most effective for recombinant TMEM133?

Purification of transmembrane proteins requires specialized approaches:

  • Membrane preparation:

    • Harvest cells and disrupt by sonication or mechanical methods

    • Separate membrane fraction by differential centrifugation

    • Wash membranes to remove peripheral proteins

  • Solubilization optimization:

    • Test multiple detergents (DDM, LMNG, CHAPS, SDS)

    • Detergent screening should be empirically determined

    • Include protease inhibitors throughout

  • Chromatography strategy:

    • Initial capture: IMAC using His6 tag

    • Intermediate purification: Ion exchange chromatography

    • Polishing: Size exclusion chromatography

  • Quality control:

    • SDS-PAGE with and without reducing agent to assess disulfide bonds

    • Western blotting with anti-TMEM133 antibodies

    • Mass spectrometry for identity confirmation

What methods can be used to assess TMEM133's role in DNA damage response?

Given TMEM133's identified role in DNA damage response , these methodologies can assess its function:

  • DNA damage assessment:

    • Comet assay to detect DNA strand breaks

    • Immunofluorescence for γH2AX foci quantification

    • TUNEL assay for DNA fragmentation

  • Cell cycle analysis:

    • Flow cytometry with propidium iodide staining

    • BrdU incorporation to measure DNA synthesis

    • Western blotting for G2/M checkpoint proteins (cyclin B1, CDC2)

  • Gene expression analysis:

    • RT-qPCR for G2/M cell cycle arrest genes

    • RNA-seq for global transcriptional changes

    • ChIP-seq to identify DNA binding sites

  • Functional rescue experiments:

    • Knockdown endogenous TMEM133 and express recombinant wildtype or mutant versions

    • Measure restoration of normal DNA damage response

    • Compare cellular phenotypes between rescue conditions

How can researchers investigate TMEM133's potential role in mitochondrial function?

Based on research with related TMEM proteins (TMEM135) , investigating mitochondrial function may be relevant:

  • Mitochondrial morphology:

    • Live-cell imaging with MitoTracker staining

    • Electron microscopy for detailed ultrastructure

    • Measure mitochondrial size and number

  • Mitochondrial dynamics:

    • Assess mitochondrial fission/fusion balance

    • Co-localization with mitochondrial dynamics proteins (e.g., DRP1)

    • Analyze effects of TMEM133 overexpression or knockdown

  • Mitochondrial function assessment:

    • Oxygen consumption rate (OCR) measurements

    • Extracellular acidification rate (ECAR)

    • Membrane potential (ΔΨM) using fluorescent dyes

    • ATP production assays

  • Oxidative stress parameters:

    • Total ROS measurements

    • Superoxide quantification

    • Expression of antioxidant enzymes (SODs, GPx1, CAT)

    • Cellular sensitivity to oxidative stressors

What strategies can overcome challenges in structural characterization of TMEM133?

Structural analysis of transmembrane proteins presents significant challenges:

  • Sample preparation approaches:

    • Crystallization screening in lipidic cubic phase

    • Nanodiscs or amphipols for membrane mimetics

    • Detergent screening for optimal solubilization

  • Structural prediction methods:

    • TMHMM for transmembrane helices prediction

    • AlphaFold2 for in silico structure prediction

    • SWISS-MODEL for homology modeling against bacterial PapD-like domains

  • Experimental structural methods:

    • X-ray crystallography for high-resolution structures

    • Cryo-EM for membrane proteins in native-like environments

    • NMR for dynamics and interaction studies

    • Hydrogen-deuterium exchange mass spectrometry

  • Functional domain mapping:

    • Serial truncation constructs

    • Site-directed mutagenesis of predicted key residues

    • Domain swapping with related TMEM proteins

How can researchers design experiments to investigate TMEM133's potential role in cancer biology?

Given TMEM133's identified role in DNA damage response and tumor growth inhibition :

  • Expression analysis in cancer:

    • Analyze TMEM133 expression across cancer types using publicly available databases

    • Perform immunohistochemistry on cancer tissue microarrays

    • Correlate expression with clinical outcomes

  • Functional assessments:

    • CRISPR-Cas9 knockout in cancer cell lines

    • Overexpression studies with wildtype and mutant TMEM133

    • Colony formation and soft agar assays

    • Xenograft models with manipulated TMEM133 expression

  • Pathway analysis:

    • Investigate interaction with ATM/ATR pathways

    • Assess downstream effects on apoptotic pathways

    • Identify binding partners through co-immunoprecipitation

    • Phosphoproteomic analysis after DNA damage induction

  • Therapeutic implications:

    • Test sensitivity to DNA-damaging agents with varied TMEM133 expression

    • Evaluate TMEM133 as a biomarker for treatment response

    • Screen for compounds that modulate TMEM133 activity

What are the methodological considerations for investigating TMEM133 mutations in neurological disorders?

For studying TMEM133's role in neurological conditions :

  • Genetic analysis approaches:

    • Targeted sequencing of TMEM133 in patient cohorts

    • Whole exome/genome sequencing for novel variant discovery

    • Functional annotation of identified variants

  • Model systems:

    • Patient-derived iPSCs differentiated to neurons

    • Knock-in mouse models with disease-associated mutations

    • CRISPR-engineered isogenic cell lines

  • Functional assays:

    • Electrophysiology for ion channel activity

    • Calcium imaging for neuronal function

    • Synaptic transmission measurements

    • Neurite outgrowth and morphology analysis

  • Molecular mechanisms:

    • Protein localization in neuronal compartments

    • Binding partner identification in neural tissues

    • Rescue experiments with wildtype TMEM133 in mutant backgrounds

How can researchers troubleshoot common issues with recombinant TMEM133 expression?

ProblemPossible CausesTroubleshooting Approaches
Low expression levelsProtein toxicity, poor codon usage, inefficient signal peptideTest rhamnose-titratable promoter system , optimize codon usage, try different signal peptides (DsbA, OmpA, PhoA, Hbp)
Inclusion body formationRapid expression rate, improper foldingLower induction temperature, reduce inducer concentration, co-express chaperones
Poor solubilizationInadequate detergent, harsh conditionsScreen multiple detergents, optimize buffer composition, test membrane scaffold proteins
Protein degradationProtease activity, unstable proteinInclude protease inhibitors, optimize buffer pH, reduce purification time
Loss of functionDenaturation, missing cofactors, incorrect foldingInclude stabilizing additives, try mammalian expression systems, verify with functional assays

What are emerging techniques that might advance TMEM133 research?

  • Single-cell technologies:

    • scRNA-seq to identify cell populations expressing TMEM133

    • Spatial transcriptomics to map expression in tissues

    • CyTOF for protein-level analysis in heterogeneous populations

  • CRISPR screening:

    • Genome-wide CRISPR screens to identify genetic interactions

    • CRISPRi/CRISPRa for functional genomics

    • Base editing for precise mutation introduction

  • Protein-protein interaction mapping:

    • BioID or APEX2 proximity labeling

    • Crosslinking mass spectrometry

    • Mammalian two-hybrid systems

  • Advanced imaging:

    • Super-resolution microscopy for precise localization

    • Live-cell imaging with FRET sensors

    • Correlative light and electron microscopy

How might recent findings about other TMEM family proteins inform TMEM133 research?

The TMEM family contains numerous proteins with diverse functions. Recent findings about related proteins can guide TMEM133 research:

  • Findings from TMEM132A studies:

    • Higher expression in tumors compared to normal tissues

    • Correlation with immune checkpoints and immune infiltration

    • Potential as immunotherapy response biomarker

  • Insights from TMEM135 research:

    • Involvement in mitochondrial dynamics regulation

    • Role in protection from oxidative stress

    • Implications in age-related diseases

  • General TMEM protein themes:

    • Roles in metabolism and cellular homeostasis

    • Involvement in cancer progression mechanisms

    • Potential as therapeutic targets

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.