Recombinant Human Transmembrane protein 143 (TMEM143)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human Transmembrane Protein 143 (TMEM143)

Recombinant Human Transmembrane Protein 143 (TMEM143) is a protein encoded by the TMEM143 gene in humans. It belongs to the family of transmembrane proteins, which are integral components of cell membranes, playing crucial roles in various cellular processes such as signaling, transport, and cell-cell interactions. Despite its importance, detailed research on TMEM143 is limited compared to other transmembrane proteins. This article aims to compile available information on TMEM143, focusing on its structure, function, and potential applications.

Potential Research Directions

Future research on TMEM143 could involve:

  • Structural Analysis: Detailed structural studies using techniques like X-ray crystallography or cryo-electron microscopy to understand its topology and interactions.

  • Functional Studies: Investigating its role in cell signaling pathways and potential involvement in disease processes.

  • Therapeutic Potential: Exploring whether TMEM143 could serve as a target for therapeutic interventions, similar to other transmembrane proteins.

Data and Tables

ProteinFunctionDisease AssociationTherapeutic Potential
TMEM88Regulates cell proliferation and signaling pathwaysAssociated with various cancersBeing explored as a therapeutic target
TMEM143UnknownNot documentedPotential for future research

References Nature article on transcription factor footprints, which mentions the use of DNase I cleavage maps but does not directly relate to TMEM143. Article on antitrypanosomal compounds, unrelated to TMEM143. Study on Turner syndrome, which does not mention TMEM143. Review on targeting TMEM88 in malignant tumors, highlighting the potential of transmembrane proteins as therapeutic targets. NCBI gene database entry for TMEM143. Study on other TMEM proteins, which could provide insights into the broader family. UniProt entry for TMEM143, detailing its amino acid sequence and status as a reviewed protein.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
TMEM143; UNQ5922/PRO19813; Transmembrane protein 143
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-459
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
TMEM143
Target Protein Sequence
MTVELWLRLRGKGLAMLHVTRGVWGSRVRVWPLLPALLGPPRALSSLAAKMGEYRKMWNP REPRDWAQQYRERFIPFSKEQLLRLLIQEFHSSPAEKAALEAFSAHVDFCTLFHYHQILA RLQALYDPINPDRETLDQPSLTDPQRLSNEQEVLRALEPLLAQANFSPLSEDTLAYALVV HHPQDEVQVTVNLDQYVYIHFWALGQRVGQMPLKSSVGSRRGFFTKLPPAERRYFKRVVL AARTKRGHLVLKSFKDTPLEGLEQLLPELKVRTPTLQRALLNLMLVVSGVAIFVNVGMVV LTDLKVATSLLLLLFAIFMGLRASKMFGQRRSAQALELAHMLYYRSTSNNSELLSALALR AQDEHTKEALLAHSFLARRPGGTQGSPEETSRWLRSEVENWLLAKSGCEVTFNGTRALAH LQALTPSMGLYPPPGFPKLDPVAPITSEPPQATPSSNIS
Uniprot No.

Target Background

Database Links

HGNC: 25603

KEGG: hsa:55260

STRING: 9606.ENSP00000293261

UniGene: Hs.351335

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is TMEM143 and what is its basic structural organization?

TMEM143 (Transmembrane protein 143) is a dual-pass protein containing two transmembrane domains that is predicted to localize to the mitochondria. The protein contains a domain of unknown function (DUF3754) within which two transmembrane domains reside - one 24 amino acids in length and the other 16 amino acids in length, both helical in nature . The transmembrane domains encompass the uncharged region present at amino acids 278 to 302 . Additionally, TMEM143 contains a predicted mitochondrial target peptide at the N-terminus spanning 52 amino acids before the cleavage site . The protein is characterized by an isoelectric point of 9.7, suggesting a basic nature under physiological conditions .

Experimentally, researchers should note that when working with recombinant forms of this protein, the presence of the mitochondrial targeting sequence may affect protein solubility and localization in heterologous expression systems. Consider generating constructs both with and without this sequence depending on your experimental goals.

What are the known transcript variants and protein isoforms of TMEM143?

The TMEM143 gene encodes five transcript variants in humans, leading to four distinct protein isoforms with the following characteristics:

VariantIsoformLength (nucleotides)Protein size (amino acids)Molecular weight (kDa)Structural differences
1a257745951.6Full-length protein
2b2472424-Lacks an in-frame exon in 5' coding region
3c2382394-Lacks an in-frame exon in 5' coding region
4d2277359-Lacks two in-frame exons in 5' coding region
5-2231--Non-coding RNA, candidate for nonsense-mediated mRNA decay

All N-terminally truncated isoforms (b, c, and d) are produced through alternative splicing mechanisms . When designing experiments targeting TMEM143, researchers should carefully consider which isoform(s) to focus on, with variant 1/isoform a being the most complete representation of the protein's function.

What is known about the genomic context and organization of the TMEM143 gene?

The TMEM143 gene is located on the negative (minus) strand of human chromosome 19, specifically at cytogenetic position 19q13.33 . The gene spans approximately 31,882 base pairs and contains 8 exons . Its chromosomal neighbors include the Coiled-coil domain containing 114 (CCDC114) gene and the ER lumen protein-retaining receptor 1 (KDELR1) gene .

When designing gene expression studies or genetic analyses, consider the following:

  • Use strand-specific methods when analyzing transcription

  • Be aware of the potential regulatory regions shared with neighboring genes

  • Consider the 8-exon structure when designing primers for PCR or other amplification techniques

What is the tissue expression pattern of TMEM143?

TMEM143 shows a distinctive tissue expression pattern with particularly high expression in both human skeletal muscle and heart tissue . The Human Protein Atlas provides comprehensive tissue expression data that can guide researchers in selecting appropriate experimental models .

When designing experiments, prioritize cell lines or primary cultures derived from tissues with high endogenous expression for functional studies. For tissues with lower expression, consider whether this represents a physiologically relevant system or if overexpression approaches might be more informative.

What are the predicted functional roles of TMEM143?

TMEM143 is predicted to act upstream of or within hematopoietic progenitor cell differentiation processes . Additionally, protein interaction studies suggest that TMEM143 could potentially play a role in tumor suppression/expression and cancer regulation . Its mitochondrial localization indicates potential involvement in mitochondrial function, though specific metabolic pathways have not been fully elucidated.

When investigating these potential functions, researchers should design experiments that:

  • Examine TMEM143 expression during hematopoietic differentiation stages

  • Assess mitochondrial function parameters when TMEM143 is overexpressed or knocked down

  • Screen for altered expression in cancer tissue samples compared to matched normal tissues

How can researchers effectively detect and quantify TMEM143 expression?

Detection and quantification of TMEM143 can be accomplished through several complementary approaches:

  • Antibody-based methods: Commercial ELISA kits specific for TMEM143 are available for protein quantification in biological samples . These kits are designed to detect native, not recombinant, TMEM143 and are appropriate for undiluted body fluids and/or tissue homogenates and secretions .

  • Transcript analysis: For mRNA expression analysis, design primers spanning exon-exon junctions to distinguish between the five transcript variants. Consider the following approach:

    • Forward primer in exon 1 and reverse primer in exon 3 to detect all variants

    • Primers flanking the alternatively spliced exons to distinguish between variants 1-4

    • Design a specific primer set for the non-coding variant 5

  • Subcellular localization: Given its predicted mitochondrial localization, co-localization studies with established mitochondrial markers can provide important functional insights.

When implementing these methods, establish appropriate positive controls using tissues known to express TMEM143 highly (skeletal muscle or heart tissue) and negative controls where expression is minimal.

What experimental approaches are best suited for studying TMEM143's mitochondrial function?

Given TMEM143's predicted mitochondrial localization and dual transmembrane domains, the following experimental approaches are recommended:

  • Mitochondrial isolation and subfractionation: Determine the precise submitochondrial localization (outer membrane, inner membrane, intermembrane space, or matrix) using protease protection assays and detergent solubilization methods.

  • Mitochondrial functional assessments:

    • Measure oxygen consumption rates using a Seahorse XF analyzer following TMEM143 knockdown or overexpression

    • Assess mitochondrial membrane potential with fluorescent probes (TMRM, JC-1)

    • Evaluate mitochondrial dynamics (fusion/fission) via live-cell imaging

  • Deletion construct analysis: Generate truncation mutants lacking the mitochondrial targeting sequence to confirm its functionality and requirement for mitochondrial localization.

When designing these experiments, utilize a systematic experimental design approach that varies multiple parameters simultaneously to account for interactions between variables that might affect mitochondrial function .

How can researchers investigate the potential role of TMEM143 in cancer regulation?

To investigate TMEM143's suggested role in cancer regulation:

  • Expression analysis in cancer datasets:

    • Query cancer genomics databases for TMEM143 expression changes across cancer types

    • Analyze correlation with patient survival and tumor stage

  • Functional studies in cancer cell lines:

    • Generate stable knockdown and overexpression cell lines using CRISPR/Cas9 or lentiviral approaches

    • Assess proliferation, apoptosis, migration, and invasion capacity

    • Examine effects on known cancer signaling pathways

  • Protein interaction studies:

    • Perform immunoprecipitation followed by mass spectrometry to identify binding partners

    • Validate key interactions using proximity ligation assays or FRET

    • Map interaction domains using deletion constructs

  • In vivo tumor models:

    • Develop xenograft models using cells with modified TMEM143 expression

    • Monitor tumor growth, metastasis, and response to therapies

When designing these studies, incorporate both gain-of-function and loss-of-function approaches to establish causality rather than mere correlation.

What are the best approaches for producing and purifying recombinant TMEM143?

For effective production of recombinant TMEM143:

  • Expression system selection:

    • Consider mammalian expression systems (HEK293, CHO) for full-length protein with post-translational modifications

    • For structural studies, bacterial systems may be used for domains lacking the transmembrane regions

    • Insect cell systems represent a compromise between proper folding and yield

  • Construct design considerations:

    • Remove the N-terminal mitochondrial targeting sequence (first 52 amino acids) to prevent mitochondrial import during expression

    • Add appropriate purification tags (His, GST, or FLAG) preferably at the C-terminus

    • Consider expressing individual domains separately for solubility

  • Purification strategy:

    • Use detergent screening to identify optimal solubilization conditions for the transmembrane domains

    • Implement a two-step purification process combining affinity chromatography with size exclusion

    • Consider nanodiscs or amphipols for maintaining the native structure of the transmembrane regions

  • Quality control:

    • Verify protein folding using circular dichroism

    • Confirm oligomeric state by analytical ultracentrifugation

    • Assess functionality through binding assays with predicted interacting partners

Document all optimization steps methodically to establish reproducible protocols for future studies.

How should researchers design experiments to study the role of TMEM143 in hematopoietic progenitor cell differentiation?

To investigate TMEM143's role in hematopoietic differentiation:

  • Expression profiling during differentiation:

    • Monitor TMEM143 expression throughout the differentiation process of hematopoietic stem cells into various lineages

    • Compare expression patterns between normal and pathological hematopoiesis

  • Loss-of-function studies:

    • Use shRNA or CRISPR to knock down TMEM143 in hematopoietic stem/progenitor cells

    • Assess effects on lineage commitment, proliferation, and maturation

    • Analyze changes in differentiation markers using flow cytometry

  • Mechanistic investigations:

    • Identify transcription factors regulating TMEM143 expression during differentiation

    • Determine downstream effectors using RNA-seq following manipulation of TMEM143 levels

    • Investigate potential roles in mitochondrial metabolism during differentiation

  • Experimental design considerations:

    • Implement a multifactorial experimental design approach that systematically varies:

      • TMEM143 expression levels

      • Differentiation inducers

      • Timepoints for analysis

      • Environmental conditions (oxygen levels, cytokines)

This comprehensive approach will help establish whether TMEM143 has a causal role in differentiation or is merely a marker of the process.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.