Recombinant Human Transmembrane protein 14C (TMEM14C)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. If you require a specific format, please specify this during order placement.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a reference for customers.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
TMEM14C; C6orf53; HSPC194; Transmembrane protein 14C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-112
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
TMEM14C
Target Protein Sequence
QDTGSVVPLHWFGFGYAALVASGGIIGYVKAGSVPSLAAGLLFGSLAGLGAYQLSQDPRN VWVFLATSGTLAGIMGMRFYHSGKFMPAGLIAGASLLMVAKVGVSMFNRPH
Uniprot No.

Target Background

Function

Essential for normal heme biosynthesis.

Gene References Into Functions
  1. Required for functional heme biosynthesis in erythroid cells. PMID: 19656490
Database Links

HGNC: 20952

OMIM: 615318

KEGG: hsa:51522

STRING: 9606.ENSP00000229563

UniGene: Hs.519557

Protein Families
TMEM14 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is TMEM14C and what is its function in heme metabolism?

    TMEM14C is an inner mitochondrial membrane protein that plays a critical role in erythroid heme metabolism. Research has demonstrated that TMEM14C functions primarily as a facilitator for the import of protoporphyrinogen IX into the mitochondrial matrix, where it can be converted to protoporphyrin IX for terminal heme synthesis .

    The importance of TMEM14C in heme synthesis was confirmed through multiple experimental approaches, including gene knockdown and knockout studies. When TMEM14C is deficient, protoporphyrin IX synthesis is blocked, leading to an accumulation of porphyrin precursors . Notably, this heme synthesis defect can be ameliorated with a protoporphyrin IX analog, confirming that TMEM14C functions primarily in the terminal steps of the heme synthesis pathway .

  • Where is TMEM14C localized in the cell?

    TMEM14C is specifically localized to the inner mitochondrial membrane. This localization was determined through rigorous subcellular fractionation and imaging studies.

    Researchers have confirmed this localization through several complementary approaches:

    • Western blot analysis of mitochondrial and cytosolic fractions from HEK293T cells showed colocalization of TMEM14C with the β-subunit of ATP synthase in the mitochondria

    • Confocal immunofluorescence of FLAG-tagged TMEM14C in COS-7 cells demonstrated colocalization with HSP60 (a mitochondrial resident protein) with a Mander's overlap coefficient greater than 0.7 and a Pearson's overlap coefficient of 0.67

    • Submitochondrial localization studies using hypotonic swelling and trypsin digestion of isolated mitochondria established that TMEM14C is an inner mitochondrial membrane protein

    The inner mitochondrial membrane localization is consistent with TMEM14C's role in facilitating the transport of porphyrin intermediates for terminal heme synthesis, which occurs within the mitochondrial matrix.

  • In which tissues is TMEM14C predominantly expressed?

    TMEM14C expression is highly enriched in hematopoietic tissues, particularly those involved in erythropoiesis. RNA sequencing and expression analyses have revealed specific patterns of expression:

    • High expression in yolk sac, bone marrow, fetal liver, and spleen

    • Expression is particularly elevated in TER119+ maturing erythroid populations of the murine fetal liver

    • β-Galactosidase staining of murine embryos carrying a Tmem14c gene trap cassette confirmed high expression in yolk sac blood cells in the vasculature at embryonic days 8.5-10.5

    • Expression analysis shows that Tmem14c is upregulated during terminal erythroid differentiation, alongside other genes involved in heme synthesis

    This tissue-specific expression pattern aligns with TMEM14C's specialized role in erythroid heme metabolism, which is critical for hemoglobin production during red blood cell development.

  • How does TMEM14C deficiency affect erythropoiesis and heme synthesis?

    TMEM14C deficiency has profound effects on both erythropoiesis and heme synthesis, as demonstrated through multiple experimental models:

    Effects on Erythropoiesis:

    • In mouse embryos, TMEM14C deficiency results in embryonic lethality by E13.5 due to profound anemia

    • Erythroid cells from TMEM14C-deficient embryos show developmental arrest at an early erythroblast stage

    • In embryoid body cultures derived from TMEM14C-deficient embryonic stem cells, researchers observed a specific decrease in hemoglobinized cells and erythroid cells, while myelopoiesis remained unaffected

    Effects on Heme Synthesis:

    • HPLC analysis of porphyrin intermediates revealed:

      • Normal levels of uroporphyrin III in TMEM14C-deficient cells

      • Significant accumulation of coproporphyrin III

      • Markedly decreased protoporphyrin IX levels

    • TMEM14C-deficient fetal livers display autofluorescence under fluorescence illumination, indicating accumulation of heme intermediates

    • 55Fe labeling experiments showed decreased heme synthesis rates in TMEM14C-deficient cells both basally and during terminal differentiation

    These findings collectively demonstrate that TMEM14C specifically affects the terminal steps of heme synthesis without impacting earlier stages of erythroid development or mitochondrial iron metabolism.

Advanced Research Questions

  • What are the optimal methods for expressing and purifying recombinant human TMEM14C?

    Expression and purification of recombinant membrane proteins like TMEM14C present unique challenges. Based on successful approaches with similar mitochondrial membrane proteins:

    Expression Systems:

    • Cell-free expression systems: These have proven effective for membrane proteins. For TMEM14C specifically, an Escherichia coli-based cell-free expression (CFE) system enriched with native membrane vesicles can be used

    • Mammalian expression systems: HEK293T cells have been successfully used for TMEM14C expression, enabling proper folding and post-translational modifications

    Purification Strategy:

    1. Express TMEM14C with an affinity tag (His-tag or FLAG-tag)

    2. Isolate mitochondria using differential centrifugation (7,000-30,000 g)

    3. Solubilize membranes using mild detergents (such as digitonin or n-dodecyl-β-D-maltoside)

    4. Purify using affinity chromatography

    5. Consider size exclusion chromatography as a polishing step

    Quality Control Assessments:

    • Western blotting to confirm identity and integrity

    • Mass spectrometry to verify sequence

    • Circular dichroism to assess secondary structure

    • Functional assays to confirm activity (porphyrin binding/transport)

    For studies requiring functional TMEM14C, it's crucial to maintain the protein in a native-like membrane environment, either through reconstitution into liposomes or nanodiscs, or by using membrane-mimetic systems.

  • What experimental approaches are most effective for studying TMEM14C's role in porphyrin transport?

    Several complementary approaches have proven effective for investigating TMEM14C's role in porphyrin transport:

    Genetic Approaches:

    • CRISPR/Cas9-mediated gene editing to generate stable knockout cell lines

    • shRNA silencing to create stable knockdown in cell models

    • Gene trap mutagenesis for animal models

    Biochemical and Cell Biology Approaches:

    • HPLC analysis of porphyrin intermediates to identify accumulation points in the pathway

    • Fluorescence microscopy to detect porphyrin accumulation (taking advantage of porphyrin autofluorescence)

    • Metabolic labeling with 55Fe to quantify heme synthesis rates

    • Complementation studies using protoporphyrin IX analogs to bypass transport defects

    Structural and Biophysical Approaches:

    • Submitochondrial fractionation combined with protease protection assays to determine membrane topology

    • Confocal microscopy with fluorescently tagged TMEM14C to determine subcellular localization

    • In vitro transport assays using purified protein reconstituted in liposomes or proteoliposomes

    A comprehensive study would combine these approaches to build a complete picture of TMEM14C's role in porphyrin transport across the inner mitochondrial membrane.

  • How can researchers differentiate between direct and indirect effects of TMEM14C deficiency on heme synthesis?

    Differentiating between direct and indirect effects of TMEM14C deficiency requires careful experimental design:

    Approaches to Establish Direct Effects:

    1. Rescue experiments: Supply protoporphyrin IX analogs to TMEM14C-deficient cells. The rescue of heme synthesis confirms that TMEM14C functions directly in porphyrin transport rather than in earlier steps

    2. Biochemical analysis of enzyme levels: Western blot analysis of heme synthesis enzymes (PPOX and FECH) in TMEM14C-deficient mitochondria showed similar protein levels compared to controls, indicating that TMEM14C does not regulate the expression of these enzymes

    3. Assessment of mitochondrial function:

      • MitoTracker Red staining revealed no differences in mitochondrial mass between TMEM14C-deficient and control cells

      • Normal activities of mitochondrial aconitase, FECH, and cytosolic xanthine oxidase in TMEM14C-deficient cells confirmed normal iron-sulfur cluster assembly in both mitochondria and cytosol

      • Normal mitochondrial iron levels, as measured by inductively coupled plasma mass spectrometry and 59Fe labeling

    4. Temporal analysis: The heme synthesis defect in TMEM14C-deficient cells is evident both basally and during terminal differentiation, indicating that it is not secondary to an erythroid differentiation defect

    These combined approaches have established that TMEM14C directly affects porphyrin transport rather than causing indirect effects through altered mitochondrial function, iron metabolism, or erythroid differentiation.

  • What are the current challenges in developing assays for measuring TMEM14C transport activity?

    Developing reliable assays for TMEM14C transport activity faces several challenges:

    Technical Challenges:

    1. Substrate instability: Porphyrinogens (the reduced form of porphyrins) spontaneously oxidize, making direct measurement difficult

    2. Membrane protein reconstitution: Maintaining functional conformation of TMEM14C during purification and reconstitution is challenging

    3. Assay sensitivity: Distinguishing between passive diffusion and protein-mediated transport of porphyrins requires highly sensitive detection methods

    Methodological Approaches:

    1. Liposome-based transport assays:

      • Reconstitute purified TMEM14C into liposomes

      • Load liposomes with fluorescent porphyrin analogs

      • Measure transport via fluorescence quenching or HPLC analysis

    2. Cell-based assays:

      • Generate cell lines with varying levels of TMEM14C expression

      • Measure porphyrin accumulation using fluorescence microscopy or HPLC

      • Compare transport rates across different expression levels

    3. Binding assays:

      • Use techniques like isothermal titration calorimetry or microscale thermophoresis to measure binding of porphyrins to purified TMEM14C

      • Determine structure-activity relationships with different porphyrin analogs

    Researchers should consider combining multiple approaches to overcome these challenges and develop robust assays for TMEM14C transport activity.

  • How can TMEM14C be targeted for potential therapeutic applications in porphyria or anemia?

    TMEM14C represents a potential therapeutic target for certain types of porphyria or anemia, with several possible intervention strategies:

    Potential Therapeutic Approaches:

    1. Small molecule modulators:

      • Design compounds that enhance TMEM14C transport activity for treating certain anemias

      • Develop inhibitors for specific porphyrias characterized by excess heme production

    2. Gene therapy approaches:

      • TMEM14C gene supplementation for cases with loss-of-function mutations

      • Delivery systems targeting erythroid precursors could provide tissue-specific correction

    3. Bypass strategies:

      • For TMEM14C deficiency, provide protoporphyrin IX analogs that can bypass the transport step

      • This approach could be particularly useful for acute management of symptoms

    Research Challenges:

    • Limited knowledge of TMEM14C structure-function relationships

    • Need for better understanding of TMEM14C regulation during erythropoiesis

    • Development of effective delivery systems for erythroid-specific targeting

    Research suggests that TMEM14C deficiency may function as a genetic modifier for the severity of anemia and porphyria in humans. Future genetic sequencing studies are predicted to uncover TMEM14C hypomorphic mutations in individuals suffering from anemias or porphyrias of unknown etiology .

  • What are the most sensitive methods for detecting TMEM14C mutations in patient samples?

    Detection of TMEM14C mutations in patient samples requires sensitive and comprehensive methods:

    DNA-based Methods:

    1. Next-generation sequencing (NGS):

      • Targeted panels including TMEM14C and other heme synthesis genes

      • Whole exome sequencing for comprehensive mutation detection

      • Whole genome sequencing to identify non-coding regulatory mutations

    2. Multiplex ligation-dependent probe amplification (MLPA):

      • Useful for detecting large deletions/duplications that might be missed by sequencing

    RNA-based Methods:

    1. RT-PCR followed by sequencing:

      • Can detect splicing mutations that might be missed by DNA sequencing

      • Useful for analyzing expression levels of TMEM14C in patient samples

    Protein-based Methods:

    1. Western blotting:

      • Using specific antibodies to detect TMEM14C protein levels

      • Can identify cases with normal mRNA but defective protein production

    Functional Assays:

    1. Porphyrin profile analysis:

      • HPLC analysis of patient samples to identify characteristic patterns of porphyrin accumulation

      • Particularly useful for identifying functional consequences of mutations

    2. Patient-derived cellular models:

      • Generation of induced pluripotent stem cells (iPSCs) from patient samples

      • Differentiation into erythroid cells to study functional impact of mutations

    These methods should be used in combination for comprehensive mutation detection and functional characterization in patient samples.

  • How does the evolutionary conservation of TMEM14C inform structure-function studies?

    Evolutionary conservation analysis of TMEM14C provides valuable insights for structure-function studies:

    Conservation Patterns:

    • TMEM14C is highly conserved across vertebrate species, indicating its fundamental importance in erythropoiesis

    • Studies have demonstrated that TMEM14C plays a critical and conserved role in both primitive and definitive erythropoiesis in vertebrate species

    Functional Implications:

    1. Conserved domains and motifs:

      • Identification of highly conserved regions suggests functionally critical domains

      • These regions should be prioritized for site-directed mutagenesis studies

    2. Species-specific variations:

      • Differences in conserved regions between species may reveal adaptations to different erythropoietic demands

      • Comparative studies between species can elucidate functional adaptations

    3. Structural predictions:

      • Conservation patterns can inform computational models of TMEM14C structure

      • Transmembrane topology predictions can be validated through experimental approaches

    4. Paralogs and related proteins:

      • Analysis of TMEM14 family members (such as TMEM14B, an important paralog of TMEM14C ) can provide insights into shared and distinct functions

      • Paralog-specific features may reveal specialized functions in heme metabolism

    Researchers can leverage evolutionary conservation data to design targeted experimental approaches for studying TMEM14C structure-function relationships, particularly focusing on highly conserved regions likely to be critical for porphyrin transport.

  • What is the current understanding of TMEM14C's role in disease pathology beyond anemia?

    While TMEM14C is primarily associated with anemia due to its critical role in erythropoiesis, research suggests potential implications in other disease contexts:

    Current Disease Associations:

    • GeneCards reports associations with Trachea Adenoid Cystic Carcinoma and Malignant Iris Melanoma

    • TMEM14C may function as a genetic modifier for the severity of porphyria in humans

    Potential Disease Mechanisms:

    1. Cancer biology:

      • Mitochondrial metabolism alterations in cancer may involve TMEM14C

      • Changes in heme metabolism have been implicated in certain cancer types

    2. Neurodegenerative disorders:

      • Mitochondrial dysfunction is a common feature of many neurodegenerative diseases

      • Altered heme metabolism has been implicated in conditions like Alzheimer's and Parkinson's disease

    3. Metabolic disorders:

      • The role of TMEM14C in mitochondrial metabolism may extend to broader metabolic functions

      • Potential interactions with other mitochondrial transporters could affect multiple metabolic pathways

    Research Gaps:

    • Limited studies on TMEM14C expression and function in non-erythroid tissues

    • Incomplete understanding of potential secondary functions beyond porphyrin transport

    • Need for comprehensive tissue-specific knockout models to assess non-erythroid phenotypes

    Further research is needed to fully elucidate TMEM14C's potential roles in disease pathologies beyond its established function in erythropoiesis and heme synthesis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.