Recombinant Human Transmembrane protein 14D (TMEM14D)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human Transmembrane Protein 14D (TMEM14D)

Recombinant Human Transmembrane protein 14D (TMEM14D) is a protein that, while not extensively studied, has been identified as playing a crucial role in specific biological processes. Research indicates its involvement in erythropoiesis and heme metabolism . Specifically, TMEM14D facilitates the import of protoporphyrinogen IX into the mitochondria for heme synthesis, which is essential for hemoglobin production .

Role in Erythropoiesis and Heme Metabolism

The significance of TMEM14D in erythropoiesis and heme metabolism has been highlighted through loss-of-function studies in mice . TMEM14D deficiency leads to porphyrin accumulation in the fetal liver, erythroid maturation arrest, and embryonic lethality due to profound anemia . Protoporphyrin IX synthesis is blocked in TMEM14D-deficient erythroid cells, resulting in the accumulation of porphyrin precursors .

The function of TMEM14D primarily involves the terminal steps of the heme synthesis pathway. Supplementation with a protoporphyrin IX analog can ameliorate the heme synthesis defect in TMEM14D-deficient cells, further supporting its role in protoporphyrinogen IX import into the mitochondrial matrix for heme synthesis and subsequent hemoglobin production .

Experimental Evidence

  • Murine Studies: Research involving murine embryonic stem cells, embryoid bodies, and Friend murine erythroleukemia (MEL) cells has consistently shown that TMEM14D is critical for both primitive and definitive erythropoiesis .

  • Tmem14c Deficiency: Experiments have shown that Tmem14c deficiency results in a decrease in hemoglobinized cells and erythroid cells, without affecting myelopoiesis . Erythroid cells derived from Tmem14c gt/gt embryoid bodies are arrested at an early erythroblast stage, indicating that TMEM14D is specifically required for erythroid terminal maturation or hemoglobin synthesis .

  • shRNA Silencing: Silencing Tmem14c in differentiating mouse fetal liver cells with shRNA hairpin constructs leads to decreased hemoglobin synthesis, confirming the continuous requirement of TMEM14D for heme synthesis in the primary definitive erythroid lineage .

  • CRISPR/Cas-Mediated Genomic Editing: CRISPR/Cas-mediated genomic editing was used to generate stable compound heterozygote knockout (CRISPR) cells. shRNA silencing was also employed to generate stable Tmem14c knockdown MEL clones. Both cell lines exhibited negligible steady-state levels of Tmem14c mRNA and protein .

Impact on Mitochondrial Function

Studies have confirmed that the absence of TMEM14D does not affect mitochondrial biogenesis or function, indicating that the heme synthetic defect is not secondary to a general defect in mitochondrial physiology .

Data on Porphyrin Intermediates

High-performance liquid chromatography (HPLC) analysis on MEL cells differentiated in the presence of dimethyl sulfoxide (DMSO) was performed to quantitate the levels of porphyrin intermediates .

TMEM14A and Glomerular Filtration

Transmembrane protein 14A (TMEM14A), a related protein, is required for maintaining the integrity of the glomerular filtration barrier . TMEM14A is an integral transmembrane protein with three transmembrane domains and has been shown to suppress Bax-mediated apoptosis .

Tables

FeatureDescription
Protein NameRecombinant Human Transmembrane protein 14D (TMEM14D)
LocationInner mitochondrial membrane
Tissue EnrichmentVertebrate hematopoietic tissues
FunctionFacilitates import of protoporphyrinogen IX into the mitochondria for heme synthesis
Deficiency Effects (Murine)Porphyrin accumulation in fetal liver, erythroid maturation arrest, embryonic lethality due to anemia, blocked Protoporphyrin IX synthesis
Experiment TypeObservation
Tmem14c DeficiencyDecrease in hemoglobinized cells and erythroid cells
shRNA Silencing of Tmem14cDecreased hemoglobin synthesis
CRISPR/Cas-Mediated knockoutNegligible levels of Tmem14c mRNA and protein
HPLC Analysis (TMEM14D deficient)Altered levels of porphyrin intermediates

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping is available upon request and incurs additional charges. Please contact us in advance to arrange this.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
TMEM14DP; TMEM14D; Transmembrane protein 14DP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-114
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
TMEM14DP
Target Protein Sequence
MEKPLFPLVPLHWFGFGYTALVVSGGIVGYVKTGRAPSLAAGLLFGSLAGVGAYQLYQDP RNVWDFLAATSVTFVGIMGMRSYYYGKFMPVGLIAGASLLMAAKVGVRMLMTSD
Uniprot No.

Target Background

Database Links

HGNC: 15660

Protein Families
TMEM14 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the membrane topology of TMEM14D and how does it compare to other TMEM14 family proteins?

TMEM14D belongs to the four-transmembrane (4TM) protein family, characterized by four membrane-spanning regions. Topology analysis using prediction tools such as TOPCONS-single confirms this arrangement . Like other members of the TMEM14 family, TMEM14D's structure suggests it functions as a transmembrane channel, potentially facilitating the transport of specific molecules across cellular membranes .

The TMEM14 family shares structural similarities, with TMEM14C being the most well-characterized member involved in protoporphyrinogen IX transport into the mitochondrial matrix for heme synthesis . The tight structure of these proteins strongly suggests they function as transmembrane channels rather than as regulatory or signaling proteins. When analyzing TMEM14D's topology, researchers should note that most 4TM proteins maintain intracellular N- and C-termini localization, although exceptions exist in certain protein families such as neurotransmitter-gated ion channels .

What genomic and expression data is available for human TMEM14D?

Human TMEM14D is identified in genomic databases with the NCBI accession number XM_928242 . Expression analysis across different tissues reveals a pattern consistent with its potential role in mitochondrial function. Unlike some membrane proteins with tissue-specific expression, current data suggests TMEM14D may be expressed in multiple tissues, similar to other proteins involved in fundamental cellular processes like heme synthesis.

The gene can be targeted for functional studies using genome editing techniques, with commercially available tools including CRISPR-Cas9 systems specifically designed for TMEM14D . These resources enable precise manipulation of TMEM14D expression for functional characterization in various cell types. When designing expression studies, researchers should consider using qPCR, RNA-seq, or proteomics approaches to determine tissue-specific expression patterns that might provide insights into TMEM14D's physiological roles.

What are the recommended protocols for TMEM14D gene knockout or knockdown studies?

For TMEM14D gene manipulation, CRISPR-Cas9 systems provide an efficient approach for gene knockout studies. Available tools include lentiviral particles containing guide RNAs (gRNAs) targeting different TMEM14D sequences along with Cas9 nuclease . A typical experimental design would include:

  • Transduction of target cells with lentiviral particles containing TMEM14D-specific gRNAs and Cas9

  • Selection of transduced cells using puromycin resistance

  • Verification of knockout efficiency through genomic PCR, sequencing, and western blot analysis

  • Phenotypic characterization comparing wildtype and knockout cells

For knockdown studies as an alternative to complete knockout, siRNA or shRNA approaches targeting TMEM14D mRNA can be employed. The advantage of knockdown is the ability to create hypomorphic conditions that may reveal phenotypes not apparent in complete knockout models. When using the CRISPR-Cas9 system, it's essential to validate editing efficiency and specificity, as off-target effects can confound experimental results .

What expression systems are most effective for recombinant TMEM14D production and purification?

For recombinant TMEM14D production, the following expression systems have proven effective for similar membrane proteins:

Expression SystemAdvantagesLimitationsPurification Tags
E. coliCost-effective, high yieldMay lack proper folding and PTMsHis6, GST, MBP
Insect cellsBetter folding, some PTMsModerate yield, more costlyHis6, FLAG, Strep-tag II
Mammalian cellsNative folding and PTMsLower yield, highest costHis6, FLAG, Twin-Strep

For membrane proteins like TMEM14D, mammalian expression systems such as HEK293 or CHO cells often provide the most physiologically relevant results despite lower yields. The expression vector should include a strong promoter (e.g., CMV for mammalian systems) and an appropriate purification tag that minimally impacts protein function .

Purification typically involves membrane isolation, solubilization with detergents (such as DDM, LMNG, or digitonin), and affinity chromatography. When designing constructs, researchers should consider placing tags on either the N- or C-terminus based on predicted topology to ensure accessibility during purification procedures.

How does TMEM14D potentially function in heme synthesis pathways based on its homology to TMEM14C?

Based on structural and sequence similarities within the TMEM14 family, TMEM14D may function in heme synthesis pathways similar to TMEM14C. TMEM14C has been shown to facilitate the transport of protoporphyrinogen IX into the mitochondrial matrix for heme synthesis, with TMEM14C deficiency causing anemia and porphyrin accumulation .

When investigating TMEM14D's potential role in heme synthesis, researchers should:

  • Quantify the relative affinities of TMEM14D to heme and tetrapyrrolic heme intermediates

  • Measure rates of in vitro heme synthesis in wildtype and TMEM14D-deficient mitochondria in the presence of exogenous heme intermediates

  • Compare TMEM14D's function with TMEM14C in reconstituted liposome transport assays

  • Assess the impact of TMEM14D knockdown on cellular heme levels and mitochondrial function

It's noteworthy that cells with TMEM14C deficiency maintain normal survival rates, mitochondrial potentials, and mitochondrial mass, suggesting functional redundancy within the TMEM14 family . TMEM14D might represent one of these redundant transporters that maintain housekeeping heme synthesis when TMEM14C is absent.

What techniques are most appropriate for investigating protein-protein interactions involving TMEM14D?

Investigating TMEM14D's interactome requires specialized approaches due to its membrane-embedded nature. The following techniques are particularly suitable:

  • Proximity labeling methods (BioID, APEX) - These approaches involve fusing a biotin ligase or peroxidase to TMEM14D, enabling biotinylation of nearby proteins that can be purified and identified by mass spectrometry.

  • Co-immunoprecipitation with crosslinking - Chemical crosslinking prior to solubilization can capture transient and weak interactions that might be disrupted during detergent extraction.

  • Split-protein complementation assays - Techniques such as split-GFP or split-luciferase can detect protein interactions in living cells with minimal disruption to the native environment.

  • Förster Resonance Energy Transfer (FRET) - For studying interactions in intact cells with high spatial resolution, though requires careful design of fluorescent protein fusions.

When interpreting interaction data, researchers should be aware that membrane protein interactions are often influenced by the lipid environment, and detergent-based methods may disrupt physiologically relevant associations . Validation of interactions using multiple complementary techniques is strongly recommended.

What disease associations have been identified for TMEM14D, and how can these inform functional studies?

While specific disease associations for TMEM14D have not been explicitly documented in the provided search results, approximately 58% of 4TM proteins have known disease associations, with 19% possibly involved in different types of cancer . By analogy with TMEM14C, whose deficiency causes anemia and porphyrin accumulation, TMEM14D dysfunction might contribute to disorders involving heme metabolism or mitochondrial function .

To investigate potential disease relevance:

  • Conduct genetic association studies comparing TMEM14D variants in patient populations with mitochondrial disorders, anemias, or porphyrias

  • Analyze gene expression databases for altered TMEM14D expression in disease states

  • Create cellular and animal models with TMEM14D deficiency to identify phenotypes relevant to human disease

  • Investigate tissue-specific effects of TMEM14D dysfunction, particularly in tissues with high heme requirements like erythroid cells and hepatocytes

Researchers should consider that TMEM14D might have both overlapping and distinct functions compared to other TMEM14 family members, potentially explaining why certain mutations lead to specific disease phenotypes despite apparent functional redundancy.

How can TMEM14D function be assessed in different tissue contexts, particularly in erythroid cells and hepatocytes?

Assessing TMEM14D function across different tissues requires targeted approaches, particularly for erythroid cells and hepatocytes which have high heme requirements:

For erythroid cells:

  • Use differentiation systems from CD34+ hematopoietic stem cells to study TMEM14D's role during various stages of erythropoiesis

  • Quantify hemoglobinization in TMEM14D-deficient erythroid cells using benzidine staining or high-performance liquid chromatography

  • Measure heme synthesis rates and intermediate accumulation in TMEM14D knockout/knockdown models

  • Assess mitochondrial parameters including membrane potential, mass, and respiratory capacity

For hepatocytes:

  • Utilize primary hepatocyte cultures or hepatocyte-like cells derived from iPSCs with TMEM14D manipulation

  • Analyze cytochrome P450 enzyme activity, which depends on heme as a cofactor

  • Measure bile acid synthesis and secretion, which may be affected by altered heme availability

  • Evaluate mitochondrial function and response to metabolic challenges

These tissue-specific approaches can reveal whether TMEM14D functions primarily in housekeeping heme synthesis or has specialized roles in tissues with high heme demands . Zebrafish models provide an excellent system for in vivo assessment of TMEM14D function in erythroid and hepatic development, as demonstrated for other TMEM14 family members.

What structural biology approaches are most promising for determining TMEM14D's three-dimensional structure?

Determining the structure of a four-transmembrane protein like TMEM14D presents technical challenges that can be addressed through several complementary approaches:

  • Cryo-electron microscopy (cryo-EM) - Increasingly the method of choice for membrane proteins, requiring purification in detergent micelles, nanodiscs, or amphipols to maintain native conformation.

  • X-ray crystallography - Though challenging for small membrane proteins, this approach may succeed with crystallization chaperones or fusion partners that provide crystal contacts.

  • NMR spectroscopy - Solution NMR is feasible for small membrane proteins like TMEM14D (when solubilized in detergent micelles) and can provide dynamic information not accessible by static methods.

  • AlphaFold2 and other prediction methods - While not experimental, these computational approaches provide increasingly accurate structural models that can guide experimental design and interpretation.

When planning structural studies, researchers should consider that the small size of TMEM14D (approximately 11-14 kDa) poses specific challenges for cryo-EM but may be advantageous for NMR approaches. Additionally, stabilizing mutations or ligands may be required to capture functionally relevant conformations during structural studies.

How can transport activity of TMEM14D be measured in reconstituted systems?

To definitively establish TMEM14D as a transporter and characterize its substrate specificity, reconstitution into artificial membrane systems is essential:

  • Liposome-based transport assays:

    • Purified TMEM14D can be reconstituted into liposomes with entrapped fluorescent dyes or radiolabeled substrates

    • Transport activity is measured as the appearance of substrate inside or outside the liposomes over time

    • For potential heme intermediate transport, protoporphyrinogen IX and other tetrapyrroles should be tested as substrates

  • Planar lipid bilayer electrophysiology:

    • For channel-like activity, TMEM14D can be incorporated into planar lipid bilayers for electrical recordings

    • This approach can determine conductance, ion selectivity, and gating properties

    • Potential regulatory molecules should be tested for their effects on channel activity

  • Solid-supported membrane (SSM)-based electrophysiology:

    • This technique is particularly useful for transporters with small or no net charge movement

    • Can detect conformational changes associated with transport cycles

When interpreting transport data, researchers should consider that TMEM14D might function as part of a larger complex in vivo, and reconstituted systems may lack essential interaction partners that modulate its activity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.