Recombinant Human Transmembrane protein 150A (TMEM150A)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant TMEM150A is typically expressed with affinity tags (e.g., His-tag) for purification. Key production parameters include:

Role in Immune Regulation

Knockdown of TMEM150A in human lung epithelial cells (H292) and HEK293-TLR4 models led to:

  • Increased cytokine production (CXCL8, IL6, CCL5) under LPS stimulation .

  • Elevated baseline cytokine levels in unstimulated cells, suggesting homeostatic regulation .

  • Enhanced transcription of pro-inflammatory genes (CXCL8, TNF, IL6) .

Phosphoinositide Signaling

TMEM150A modulates phosphatidylinositol 4-phosphate (PI(4)P) synthesis by:

  • Associating with phosphatidylinositol 4-kinase (PI4KIIIα) and EFR3B in membrane microdomains .

  • Regulating PI(4,5)P<sub>2</sub> distribution, which impacts TLR4 signaling and autophagy .

Autophagy and Cellular Homeostasis

  • Linked to fasting-induced autophagy in liver cells .

  • Orthologs (e.g., DRAM1) are implicated in p53-mediated autophagy .

Research Tools and Applications

Recombinant TMEM150A is utilized in:

  • Mechanistic studies of phosphoinositide signaling and membrane dynamics .

  • Immunoassays: Antibodies targeting TMEM150A (e.g., HPA019015) enable immunohistochemistry and Western blotting .

  • Gene delivery: AAV vectors (e.g., AAV-225768) express TMEM150A in vitro or in vivo .

Clinical and Therapeutic Implications

While direct therapeutic applications remain exploratory, TMEM150A’s regulatory roles in inflammation and autophagy highlight its potential as a:

  • Biomarker for immune dysregulation.

  • Target for modulating TLR4-driven pathologies (e.g., sepsis, chronic inflammation) .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline for your reconstitution.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
TMEM150A; TMEM150; Transmembrane protein 150A; Transmembrane protein 150
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
25-271
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
TMEM150A
Target Protein Sequence
MAVMNHHVCPVENWSYNESCPPDPAEQGGPKTCCTLDDVPLISKCGSYPPESCLFSLIGN MGAFMVALICLLRYGQLLEQSRHSWVNTTALITGCTNAAGLLVVGNFQVDHARSLHYVGA GVAFPAGLLFVCLHCALSYQGATAPLDLAVAYLRSVLAVIAFITLVLSGVFFVHESSQLQ HGAALCEWVCVIDILIFYGTFSYEFGAVSSDTLVAALQPTPGRACKSSGSSSTSTHLNCA PESIAMI
Uniprot No.

Target Background

Function
TMEM150A regulates phosphatidylinositol 4-kinase (PI4K) localization to the plasma membrane, potentially by reducing the interaction between TTC7 (TTC7A or TTC7B) and the PI4K complex. It functions as a regulator of phosphatidylinositol 4-phosphate (PtdIns(4)P) synthesis and may also play a role in fasting-induced catabolism.
Gene References Into Functions
  1. TMEM150A, a functional mammalian homolog of Sfk1, contributes to the homeostatic regulation of PI(4,5)P2 at the plasma membrane. PMID: 25608530
Database Links

HGNC: 24677

OMIM: 616757

KEGG: hsa:129303

STRING: 9606.ENSP00000334708

UniGene: Hs.591559

Protein Families
DRAM/TMEM150 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is TMEM150A and what cellular functions does it regulate?

TMEM150A, also known as TM6P1 or damage-regulated autophagy modulator 5, is a conserved transmembrane protein that functions primarily in regulating phosphoinositide production at the plasma membrane. It plays a critical role in modifying the composition of the phosphatidylinositol 4-kinase enzyme complex, which directly influences PI(4,5)P2 production . TMEM150A has been implicated in maintaining cellular homeostasis, particularly in relation to cytokine expression and secretion . Research has demonstrated that it positively regulates phosphoinositide production at the plasma membrane, suggesting a connection to autophagosome formation and lysosomal fusion . TMEM150A transcript levels increase in the liver under fasting conditions, which typically induce autophagy, further supporting its role in autophagy regulation .

How is TMEM150A structurally organized and where is it primarily expressed?

TMEM150A belongs to the TMEM150/FRAG1/DRAM protein family and contains multiple transmembrane domains . It is conserved across eukaryotes, with homologs identified in various species including yeast (Sfk1) . The protein interacts with PI 4 kinase and is involved in phospholipid dynamics at the plasma membrane . Expression analysis indicates that TMEM150A is present in various tissues, with notable expression in epithelial cells, including those of the lung and kidney . The protein's structural organization facilitates its interaction with membrane components and signaling proteins, particularly those involved in phosphoinositide metabolism.

What experimental models are commonly used to study TMEM150A function?

Researchers typically employ several experimental systems to investigate TMEM150A:

  • Cell line models: Human embryonic kidney (HEK) cell lines modified to express TLR4 and epithelial cell lines like NCI-H292 (lung carcinoma epithelial cells) are frequently used .

  • siRNA knockdown approaches: Small interfering RNA targeting TMEM150A (demonstrated efficacy with siRNA "C" from Origene Technologies) transfected using Lipofectamine RNAiMax is a standard method for studying loss-of-function effects .

  • Validation techniques: RT-qPCR for transcript analysis and Western blotting with specific antibodies (e.g., anti-TMEM150A antibody NBP1-81885 from Novus Biologicals) are commonly employed to confirm knockdown efficiency .

  • Functional assays: Measurements of cytokine production (both at transcript and protein levels) in response to stimuli like LPS provide insights into TMEM150A's role in cellular signaling .

How does TMEM150A regulate TLR4-mediated immune responses?

TMEM150A plays a critical regulatory role in TLR4-mediated immune responses by modulating cytokine production. Experimental evidence indicates that knockdown of TMEM150A in TLR4-expressing epithelial cells results in significantly increased levels of LPS-induced cytokine secretion and corresponding transcript levels . This suggests that TMEM150A normally functions as a negative regulator of TLR4 signaling. The mechanism appears to involve TMEM150A's ability to regulate PI(4,5)P2 production at the plasma membrane, which is critical for TLR4 signal transduction .

When TMEM150A expression is reduced, both basal and LPS-stimulated production of multiple cytokines increases, including CXCL8, CCL5, IL6, and TNF . Interestingly, this effect is observed even in unstimulated conditions in certain cell types (like H292 lung epithelial cells), indicating that TMEM150A is essential for maintaining cytokine homeostasis beyond just TLR4-activated pathways .

What is the relationship between TMEM150A and phosphoinositide metabolism?

TMEM150A directly influences phosphoinositide metabolism by regulating the phosphatidylinositol 4-kinase (PI4K) enzyme complex. Specifically, TMEM150A interacts with the PI4KIIIα complex and affects the localization and activity of this kinase . This interaction impacts the production of PI(4)P, which is subsequently converted to PI(4,5)P2—a critical plasma membrane lipid involved in various signaling pathways .

Research suggests that TMEM150A impacts the distribution of PI4KIIIα between different membrane domains through its interaction with EFR3B, a component of the PI4K complex . The palmitoylation state of EFR3B regulates its interactions with TMEM150A and subsequent relocation of PI4KIIIα between different membrane domains . Knockdown of TMEM150A likely results in:

How does TMEM150A influence autophagy mechanisms?

TMEM150A has been identified as a damage-regulated autophagy modulator, suggesting a significant role in autophagy regulation . Several lines of evidence support this connection:

  • TMEM150A transcript levels increase in the liver under fasting conditions, which are known inducers of autophagy .

  • The protein positively regulates phosphoinositide production at the plasma membrane, providing a link to autophagosome formation and lysosomal fusion processes .

  • TMEM150A belongs to the DRAM family, members of which are established regulators of autophagy .

The connection between TMEM150A and autophagy is particularly significant in the context of immune responses, as autophagy can be activated by infection and immune stimulation . TLR4 engagement by LPS can induce autophagy, and DRAM1 (related to TMEM150A) influences autophagy downstream of TLR4/MyD88 signaling as a prosurvival response to infection . This suggests that TMEM150A may integrate immune signaling with autophagy regulation, potentially serving as a feedback mechanism to control inflammatory responses.

What role does TMEM150A play in glioblastoma multiforme (GBM)?

TMEM150A has emerged as a significant factor in glioblastoma multiforme pathology. Studies have demonstrated that TMEM150A is significantly overexpressed in GBM tissues compared to normal brain tissues, with an area under the ROC curve of 0.95, indicating its potential as a diagnostic biomarker . This overexpression strongly correlates with poor clinical outcomes, including:

Experimental investigations reveal that suppressing TMEM150A expression inhibits GBM cell proliferation, migration, and invasion capabilities . These findings suggest TMEM150A may drive tumor aggressiveness through multiple mechanisms. The prognostic value of TMEM150A appears particularly strong in specific patient subgroups, including:

  • Both male and female patients

  • Patients regardless of race

  • Patients aged ≤60 years

  • Patients with Karnofsky Performance Status (KPS) ≥80

  • Patients with IDH wild-type status

How does TMEM150A expression influence the tumor microenvironment in cancer?

TMEM150A expression significantly impacts the tumor microenvironment, particularly regarding immune cell infiltration and function. Analysis of TCGA data from GBM patients shows that TMEM150A overexpression associates with:

These findings suggest that TMEM150A may contribute to an immunosuppressive microenvironment that facilitates tumor progression. The correlation between TMEM150A expression and immune infiltration patterns provides insight into potential mechanisms by which this protein might influence cancer development and treatment response. The specific impact on T cell subsets suggests effects on both pro-inflammatory (Th17) and regulatory/suppressive (Th2, Tregs) immune responses.

What is the connection between TMEM150A and RNA modifications in disease contexts?

Recent research has uncovered intriguing connections between TMEM150A and RNA modifications, which may represent an additional mechanism through which this protein influences disease processes. Analysis using the RM2TARGET database has identified TMEM150A as a target gene associated with various RNA modifications, including:

  • m6A (N6-methyladenosine)

  • m1A (N1-methyladenosine)

  • m5C (5-methylcytosine)

  • m7G (7-methylguanosine)

In the context of GBM, correlations have been observed between TMEM150A expression levels and these RNA modifications . This suggests that TMEM150A may be regulated post-transcriptionally through RNA modification mechanisms, or alternatively, that TMEM150A itself might influence RNA modification processes affecting other genes. These findings open new avenues for understanding how TMEM150A contributes to disease pathogenesis beyond its direct protein functions and interactions.

What are the optimal approaches for TMEM150A knockdown in cellular models?

Based on published research, several effective approaches for TMEM150A knockdown have been established:

siRNA-mediated knockdown:

  • Reagent selection: Three TMEM150A siRNAs (designated "A," "B," and "C") have been evaluated, with siRNA "C" from Origene Technologies (catalog SR315062) demonstrating the highest efficiency .

  • Transfection protocol: Successful transfection has been achieved using 5 pmol siRNA with Lipofectamine RNAiMax (Life Tech 13778) according to manufacturer's protocol .

  • Cell-specific timing: For HEK-TLR4 cells, optimal transfection occurs after cells are adherent post-plating (~18 hours), while H292 cells show better results when transfection is performed concurrent with plating .

Validation methods:

  • Transcript level: RT-qPCR analysis using specific primers for TMEM150A

  • Protein level: Western blotting using anti-TMEM150A antibody (NBP1-81885; Novus Biologicals) at 1:750 dilution with overnight incubation at 4°C

Considerations for effective knockdown:

  • Different cell lines may require optimization of transfection conditions

  • Validation at both transcript and protein levels is essential

  • Including appropriate controls (e.g., scrambled siRNA) is critical for accurate interpretation

How can researchers effectively measure functional consequences of TMEM150A modulation?

Several experimental approaches can effectively assess the functional impact of TMEM150A modulation:

Cytokine production assessment:

  • Protein secretion: ELISA or multiplex assays for cytokines including CXCL8, CCL5, IL6, IL12B, and TNF in cell culture supernatants

  • Transcript analysis: RT-qPCR for cytokine gene expression to determine if changes occur at transcriptional level

  • Dose-response testing: Evaluating responses across different concentrations of stimuli (e.g., 0, 30, and 100 ng/mL LPS) to capture subtle effects

Phosphoinositide metabolism evaluation:

  • Measurement of PI(4)P and PI(4,5)P2 levels using specific antibodies or biosensors

  • Analysis of PI4K activity and localization through immunofluorescence or fractionation techniques

Cell biological phenotypes:

  • For cancer research: Proliferation, migration, and invasion assays in relevant cell lines following TMEM150A knockdown or overexpression

  • For immune response studies: TLR4 pathway activation markers, NF-κB translocation, or downstream signaling events

In vivo correlations:

  • Analysis of TMEM150A expression in patient samples (e.g., cancer tissues) using immunohistochemistry

  • Correlation with clinical parameters (age, survival data, disease progression)

What are the challenges and considerations when using recombinant TMEM150A protein in research?

Working with recombinant TMEM150A protein presents several technical challenges and considerations:

Production challenges:

  • As a transmembrane protein, TMEM150A is difficult to express and purify in its native conformation

  • Selection of appropriate expression systems (bacterial, mammalian, insect, or cell-free) affects protein folding and post-translational modifications

  • Purification strategies must be optimized to maintain protein stability and functionality

Experimental applications:

  • Recombinant TMEM150A proteins serve as valuable tools for:

    • Generating and validating antibodies

    • Structural studies (though challenging for membrane proteins)

    • Binding assays to identify interaction partners

    • In vitro functional studies

Quality control considerations:

  • Verification of proper folding and post-translational modifications

  • Assessment of biological activity compared to native protein

  • Batch-to-batch consistency in activity and purity

  • Storage conditions that maintain protein stability

Specific research approaches:

  • Using truncated versions containing specific domains for interaction studies

  • Creating fusion proteins with tags that facilitate detection or purification

  • Developing specific activity assays to confirm functional integrity

How does TMEM150A coordinate with phospholipid flippases to maintain membrane homeostasis?

Recent research has uncovered potential interactions between TMEM150A and phospholipid flippases that contribute to membrane homeostasis. In yeast, Sfk1 (the homolog of human TMEM150A) was isolated as a multicopy suppressor of the lem3Δ mutant, which affects phosphatidylethanolamine (PE) and phosphatidylserine (PS) exposure in the plasma membrane . This suggests TMEM150A may function in concert with phospholipid flippases to maintain proper lipid asymmetry across membrane bilayers.

The relationship appears to be complex:

  • Sfk1/TMEM150A might negatively regulate transbilayer movement of phospholipids irrespective of direction .

  • Double mutants lacking both Lem3 and Sfk1 exhibit more severe defects in PE and PS asymmetry than single mutants .

  • Loss of both proteins increases plasma membrane permeability, suggesting fundamental roles in membrane barrier function .

These findings highlight a potential coordinating role for TMEM150A in maintaining phospholipid asymmetry, which is crucial for various cellular processes including signal transduction, membrane protein function, and cell viability. The interaction with flippases may represent an additional mechanism by which TMEM150A influences PI(4,5)P2 distribution and signaling beyond its direct effects on PI4K activity.

What is the mechanistic relationship between TMEM150A expression and RNA modification patterns?

The relationship between TMEM150A and RNA modifications represents an emerging area of research with significant implications. Analysis using the RM2TARGET database has identified TMEM150A as a target associated with several RNA modifications, including m6A, m1A, m5C, and m7G . This raises important mechanistic questions:

  • Regulatory relationship: Does TMEM150A influence RNA modification pathways, or is TMEM150A expression itself regulated by RNA modification?

  • Modification-specific effects: Different modifications may have distinct impacts on TMEM150A expression or function, potentially creating a complex regulatory network.

  • Disease relevance: In GBM, TMEM150A expression correlates with RNA modification patterns, suggesting potential therapeutic targets .

This emerging field connects TMEM150A to epitranscriptomic regulation, which affects gene expression through post-transcriptional mechanisms. Understanding these connections may reveal new approaches to modulating TMEM150A activity beyond direct protein targeting, potentially offering alternative therapeutic strategies for diseases where TMEM150A dysregulation plays a role.

What are the emerging therapeutic opportunities targeting TMEM150A in disease contexts?

Given TMEM150A's roles in multiple cellular processes and its dysregulation in diseases like GBM, several therapeutic approaches are emerging:

In cancer therapy:

  • Direct targeting strategies: Developing specific inhibitors of TMEM150A function or expression could potentially suppress tumor growth, migration, and invasion .

  • Biomarker applications: TMEM150A overexpression strongly predicts poor prognosis in GBM patients, suggesting its utility as a stratification marker for clinical trials or treatment selection .

  • Combination approaches: Given TMEM150A's association with immune cell infiltration, combining TMEM150A inhibition with immunotherapies might enhance treatment efficacy .

In inflammatory conditions:

  • Modulation of TLR4 signaling: Since TMEM150A regulates cytokine production downstream of TLR4, targeting this pathway might help control excessive inflammation in conditions like sepsis .

  • Restoration of cytokine homeostasis: In conditions with dysregulated cytokine production, restoring normal TMEM150A function could potentially reestablish balance .

Technological approaches:

  • Small molecule inhibitors targeting protein-protein interactions

  • RNA interference or antisense oligonucleotides to reduce expression

  • PROTAC (proteolysis targeting chimeras) technology for targeted protein degradation

  • Gene therapy approaches for conditions requiring TMEM150A restoration

These therapeutic strategies remain largely theoretical but represent promising avenues for future research and development based on our current understanding of TMEM150A biology.

How does TMEM150A integrate membrane biology, signaling, and cellular homeostasis?

TMEM150A functions at the intersection of multiple cellular processes, creating an integrated regulatory network:

  • Membrane organization: TMEM150A influences phospholipid distribution across membrane leaflets, potentially working with flippases to maintain membrane asymmetry and integrity . This fundamental role affects membrane fluidity, permeability, and the distribution of membrane microdomains.

  • Phosphoinositide regulation: By modulating PI4K complex composition and activity, TMEM150A directly impacts PI(4,5)P2 production and distribution . This affects:

    • Membrane-cytoskeleton interactions

    • Ion channel function

    • Receptor activation and endocytosis

    • Signal transduction pathways

  • Immune signaling modulation: TMEM150A regulates TLR4-mediated cytokine production, functioning as a negative regulator of inflammatory responses . This creates a feedback loop between membrane composition and immune activation.

  • Autophagy regulation: As a damage-regulated autophagy modulator, TMEM150A connects membrane dynamics to cellular stress responses and homeostatic mechanisms .

This integrative role positions TMEM150A as a coordinator between membrane organization and multiple cellular signaling networks, allowing cells to adapt their responses based on membrane status and environmental cues.

What contradictions exist in the current TMEM150A literature, and how might they be resolved?

Several notable contradictions or knowledge gaps exist in the current TMEM150A literature:

Contradictory roles in different contexts:

  • TMEM150A appears to negatively regulate cytokine production in epithelial cells , yet its overexpression correlates with inflammation-related processes in GBM .

  • TMEM150A has connections to both autophagy promotion and cancer progression , which seems paradoxical given autophagy's typical tumor-suppressive role in early cancer stages.

Resolution approaches:

  • Context-dependent studies: Systematic comparison of TMEM150A function across different cell types and disease states

  • Mechanistic dissection: Identifying specific protein domains responsible for different functions

  • Temporal analysis: Examining how TMEM150A effects change over time in development or disease progression

Technical limitations creating apparent contradictions:

  • Different model systems (cell lines, tissues, organisms) may yield different results

  • Various knockdown or overexpression efficiencies across studies

  • Lack of standardized reagents and protocols

Standardization strategies:

  • Development of validated antibodies and recombinant proteins

  • Establishment of reference datasets and benchmarking protocols

  • Cross-validation across multiple experimental systems

Addressing these contradictions will require integrated approaches combining structural biology, functional genomics, and systems biology to develop a more comprehensive understanding of TMEM150A biology.

What is the evolutionary significance of TMEM150A conservation across species?

The conservation of TMEM150A across diverse eukaryotic species suggests fundamental biological significance:

Evolutionary insights:

  • TMEM150A belongs to the conserved TMEM150/FRAG1/DRAM family, with homologs identified across species including the yeast protein Sfk1 .

  • This conservation indicates essential functions in core cellular processes that evolved early in eukaryotic development.

  • The protein's role in membrane organization, particularly phospholipid asymmetry, aligns with the universal importance of membrane compartmentalization in eukaryotes.

Functional conservation and divergence:

  • Core functions related to membrane organization and phosphoinositide regulation appear conserved from yeast to humans .

  • Species-specific roles may have evolved in higher organisms, particularly in immune signaling regulation .

  • Comparative studies between yeast Sfk1 and human TMEM150A reveal both shared and distinct functions, providing insights into evolutionary adaptation .

Evolutionary pressures:

  • Membrane organization represents a fundamental aspect of eukaryotic cellular architecture, explaining strong conservation pressure.

  • Connections to both basic cellular processes (autophagy) and specialized functions (immune regulation) suggest acquisition of new roles during evolution.

  • The protein's involvement in response to environmental stressors (such as nutrient limitation triggering autophagy) indicates its importance in adaptation and survival.

This evolutionary perspective provides context for understanding TMEM150A's diverse functions and may guide future research into its fundamental biological significance.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.