Recombinant Human Transmembrane protein 160 (TMEM160)

Shipped with Ice Packs
In Stock

Description

Introduction

Transmembrane protein 160 (TMEM160) is a protein encoded by the TMEM160 gene in humans . TMEM160 is located in the inner mitochondrial membrane . Research indicates that TMEM160 may influence intracellular responses, particularly those related to mitochondrial function and oxidative stress .

Gene and Protein Information

The TMEM160 gene in humans encodes the transmembrane protein 160 . TMEM160 is a transmembrane protein located in the mitochondrial inner membrane .

Intracellular Localization and Function

Recent studies have localized TMEM160 to the inner mitochondrial membrane . TMEM160 may suppress the generation of reactive oxygen species (ROS) and stabilize mitochondrial proteins .

Impact of TMEM160 Depletion

Knockdown of TMEM160 in human cultured cells leads to an upregulation of the mitochondrial chaperone HSPD1, suggesting the induction of the mitochondrial unfolded protein response (UPRmt) . Expression of key transcription factors that induce UPRmt, such as ATF4, ATF5, and DDIT3, increases following TMEM160 depletion . TMEM160 depletion upregulates the expression of mitochondrial protein import receptors TOMM22 and TOMM20 .

4.1. Reactive Oxygen Species (ROS)

TMEM160 depletion leads to a significant increase in reactive oxygen species (ROS) generation . In TMEM160-depleted cells, glutathione S-transferases, which detoxify oxidative stress products, are also upregulated .

4.2. Effects on Mitochondrial Proteins

Following TMEM160 depletion, the expression patterns of 4-hydroxynonenal (4-HNE)-modified proteins are altered, suggesting enhanced degradation of these proteins . The upregulation of HSPD1, TOMM22, ATF4, ATF5, and DDIT3 persists even after scavenging ROS with N-acetylcysteine, suggesting that UPRmt induction by TMEM160 depletion is independent of ROS detoxification .

5.1. Immunoblot Analysis

Immunoblot analysis using anti-DYKDDDDK antibody detected a strong band corresponding to TMEM160-Myc-DYKDDDDK only in the lysate of TMEM160-Myc-DYKDDDDK-expressing cells . Using anti-TMEM160 antibody, a band corresponding to endogenous TMEM160 was detected in the lysates of both control and TMEM160-Myc-DYKDDDDK-expressing cells .

5.2. Mitochondrial Localization

Immunofluorescence imaging of TMEM160-Myc-DYKDDDDK-expressing HeLa cells treated with Mito Tracker Red showed that the fluorescence image of Alexa Fluor488 was almost identical to that of Mito Tracker Red, indicating the localization of TMEM160-Myc-DYKDDDDK in the mitochondria .

5.3. Alkali Resistance

The TMEM160 protein was detected in the alkali-resistant pellet fraction along with MTCO1, VDAC1, and TOMM22, whereas ATP5A and HSPA9 were not .

TMEM160 and Cancer

TMEM160 is significantly upregulated in lung adenocarcinoma and cervical cancer, where it is found in both the cytoplasm and nucleus . TMEM165, another transmembrane protein, is overexpressed in hepatocellular carcinoma (HCC), and its depletion weakens the invasive activity of cancer cells through suppression of matrix metalloproteinase-2 (MMP-2) expression .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
TMEM160; Transmembrane protein 160
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-188
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
TMEM160
Target Protein Sequence
MGGGWWWARAARLARLRFRRSLLPPQRPRSGGARGSFAPGHGPRAGASPPPVSELDRADA WLLRKAHETAFLSWFRNGLLASGIGVISFMQSDMGREAAYGFFLLGGLCVVWGSASYAVG LAALRGPMQLTLGGAAVGAGAVLAASLLWACAVGLYMGQLELDVELVPEDDGTASAEGPD EAGRPPPE
Uniprot No.

Target Background

Database Links

HGNC: 26042

KEGG: hsa:54958

STRING: 9606.ENSP00000253047

UniGene: Hs.105606

Protein Families
TMEM160 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is known about TMEM160's role in normal cellular physiology?

TMEM160 appears to play important roles in maintaining mitochondrial homeostasis. Research indicates that it suppresses reactive oxygen species (ROS) generation and may help stabilize mitochondrial proteins . When TMEM160 is depleted, cells exhibit increased ROS production and activation of mitochondrial stress responses, suggesting it normally functions to maintain mitochondrial integrity . Additionally, TMEM160 has been implicated in neuropathic pain pathways, though this function requires further investigation .

What cellular pathways are affected by TMEM160 depletion?

TMEM160 knockdown triggers several significant cellular responses:

  • Upregulation of mitochondrial chaperone HSPD1

  • Induction of the mitochondrial unfolded protein response (UPRmt)

  • Increased expression of key UPRmt transcription factors (ATF4, ATF5, and DDIT3)

  • Enhanced expression of mitochondrial protein import receptors (TOMM22 and TOMM20)

  • Significant increase in ROS generation

  • Upregulation of glutathione S-transferases (detoxify oxidative stress products)

These pathways remain upregulated even after ROS scavenging with N-acetylcysteine, suggesting that once UPRmt is initiated by TMEM160 depletion, it operates independently of subsequent ROS levels .

How does TMEM160 contribute to cancer progression?

TMEM160 appears to promote multiple aspects of cancer progression across different tumor types:

Cancer TypeTMEM160-Related EffectsResearch Methods
Colorectal CancerPromotes proliferation, invasion, metastasis, clonogenicity, and radioresistancesiRNA knockdown, lentiviral vectors, in vivo mouse models
Lung AdenocarcinomaEnhances proliferation and migrationCRISPR/Cas9 knockout, MTT assay, wound closure assay, transwell migration assay
Cervical CancerSupports tumor growthIn vivo xenograft models

High TMEM160 expression correlates with worse prognosis in colorectal cancer patients, suggesting clinical relevance beyond experimental models .

What is the mechanism by which TMEM160 affects PD-L1 expression?

TMEM160 regulates PD-L1 through a novel protein stabilization mechanism:

  • TMEM160 directly binds to PD-L1 (confirmed via Co-IP and GST pull-down assays)

  • This binding competes with SPOP (Speckle-type POZ protein), which normally mediates PD-L1 ubiquitination

  • By preventing SPOP binding, TMEM160 inhibits ubiquitination-dependent degradation of PD-L1

  • This stabilizes PD-L1 expression on the cancer cell surface

  • Elevated PD-L1 promotes immune evasion by inhibiting CD8+ T cell activity

This mechanism explains how TMEM160 contributes to immune evasion in the tumor microenvironment, particularly in colorectal cancer.

How does TMEM160 expression correlate with immune cell infiltration in tumors?

In clinical colorectal cancer samples, researchers observed significant correlations between TMEM160 expression and immune parameters:

  • Strong positive correlation between TMEM160 and PD-L1 expression

  • Negative correlation between TMEM160 and CD8A expression (marker for cytotoxic T cells)

  • High TMEM160 expression associated with reduced CD8+ T cell infiltration in tumor tissues

These findings suggest TMEM160 creates an immunosuppressive microenvironment by both upregulating immune checkpoint molecules and reducing cytotoxic T cell presence.

What techniques are most effective for studying TMEM160 protein interactions?

Several complementary approaches have proven effective for investigating TMEM160's protein interactions:

  • Co-immunoprecipitation (Co-IP): Successfully used to detect TMEM160 binding to PD-L1 and SPOP in cancer cell lines using the Protein A/G Immunoprecision Kit protocol .

  • GST pull-down assay: Employed to confirm direct binding between recombinant TMEM160 and PD-L1 proteins. This requires:

    • Purified proteins (Recombinant Human PD-L1, TMEM160 Fusion Protein, GST Tag Fusion Protein)

    • GST Pull-Down Kit following manufacturer's protocol

    • Analysis via gel electrophoresis and western blotting

  • Molecular docking: Computational approach using:

    • 3D structure of PD-L1 from Protein Data Bank

    • Predicted 3D structure model of TMEM160 from UniProt

    • Discovery Studio software (BIOVIA) with ZDOCK and RDOCK modules for protein-protein docking

  • Immunofluorescence assays: For visualizing protein co-localization in fixed cells using:

    • Cell culture on glass slides

    • 4% PFA fixation and 2% Triton permeabilization

    • Blocking with 10% BSA

    • Primary and secondary antibody incubation

    • DAPI nuclear staining

What approaches should be used to study TMEM160's effect on protein stability?

Researchers have successfully employed several methodological approaches:

  • Cycloheximide (CHX) half-life assay:

    • Treat cells with CHX (40 μg/ml) to block new protein synthesis

    • Harvest cells at different time points (0, 2, 4, 8 hours)

    • Analyze protein degradation rate via western blotting

    • Compare half-life in TMEM160 knockdown vs. control cells

  • MG132 rescue assay:

    • Knockdown TMEM160 in target cells

    • Treat with proteasome inhibitor MG132 (10 μM for 6 hours)

    • Extract proteins and analyze by western blot

    • Determine if MG132 restores reduced protein levels, indicating proteasomal degradation

  • Ubiquitination assay:

    • Immunoprecipitate target protein

    • Detect ubiquitinated forms using anti-ubiquitin antibodies

    • Compare ubiquitination levels with and without TMEM160 expression

What genetic manipulation strategies are appropriate for TMEM160 functional studies?

Several genetic approaches have been validated for TMEM160 research:

  • CRISPR/Cas9 system:

    • Successfully used to silence TMEM160 expression in A549 lung cancer cells

    • Requires confirmation of knockout efficiency via western blotting

    • Control cells should be transfected with non-targeting plasmid

  • siRNA knockdown:

    • Effective for transient TMEM160 depletion in human cultured cells

    • Allows analysis of immediate cellular responses to TMEM160 loss

  • Lentiviral vector systems:

    • Suitable for creating stable TMEM160 knockdown or overexpression cell lines

    • Essential for long-term experiments and in vivo studies

    • May require cell sorting to isolate cells with consistent expression levels

How should researchers address contradictions in TMEM160 localization data?

While initially characterized as a mitochondrial protein, newer studies show TMEM160 in nuclear and cytoplasmic compartments . To resolve these contradictions:

  • Employ multiple localization techniques:

    • Subcellular fractionation with western blotting

    • Immunofluorescence with co-localization markers

    • Super-resolution microscopy for detailed visualization

    • Live-cell imaging with tagged TMEM160

  • Consider cell-type specificity:

    • Compare localization across different cell types

    • Evaluate localization in normal versus cancer cells

    • Assess whether localization changes with cell cycle phases

  • Validate antibody specificity:

    • Use multiple antibodies targeting different epitopes

    • Include TMEM160 knockout controls

    • Confirm specificity with tagged TMEM160 constructs

What are the experimental challenges in studying the dual function of TMEM160?

TMEM160 exhibits roles in both mitochondrial function and immune regulation, creating several research challenges:

  • Separating direct from indirect effects:

    • Does TMEM160 depletion affect PD-L1 through ROS-mediated signaling?

    • Are mitochondrial effects secondary to nuclear functions or vice versa?

  • Temporal considerations:

    • Acute versus chronic TMEM160 depletion may show different phenotypes

    • Compensatory mechanisms may mask certain functions over time

  • Methodological approach:

    • Domain mapping to identify regions responsible for specific functions

    • Mutant constructs that selectively disrupt one function while preserving others

    • Compartment-specific targeting to restrict TMEM160 to specific organelles

How should researchers design experiments to investigate TMEM160's role in radioresistance?

Given TMEM160's involvement in radiotherapy resistance , investigators should:

  • Establish clinically relevant radiation models:

    • Use fractionated radiation protocols that mimic clinical regimens

    • Compare single high-dose versus fractionated low-dose radiation

  • Assess multiple radioresistance parameters:

    • Clonogenic survival assays (gold standard)

    • DNA damage repair kinetics (γH2AX foci)

    • Cell cycle checkpoint activation

    • Mitotic catastrophe and senescence markers

  • Investigate mechanism:

    • Determine if radioresistance is linked to PD-L1/immune mechanisms

    • Assess whether ROS regulation by TMEM160 affects radiation sensitivity

    • Investigate DNA damage response pathway involvement

What evidence supports TMEM160 as a potential therapeutic target?

Several findings suggest TMEM160 may be a promising therapeutic target:

  • Clinical correlations:

    • High TMEM160 expression correlates with worse prognosis in colorectal cancer patients

    • Positive correlation with PD-L1 and negative correlation with CD8A expression in clinical samples

  • Functional validation:

    • TMEM160 knockdown inhibits multiple cancer hallmarks (proliferation, invasion, migration)

    • TMEM160 depletion reduces tumor growth in vivo in multiple cancer models

  • Immune modulation potential:

    • TMEM160 inhibition could enhance anti-tumor immunity by reducing PD-L1 expression

    • May sensitize tumors to immune checkpoint inhibitors

  • Radiation sensitization:

    • TMEM160 depletion reduces radioresistance in cancer models

    • Suggests potential as a radiosensitizer in combination therapy approaches

What experimental models are most appropriate for preclinical evaluation of TMEM160-targeting therapies?

Researchers should consider multiple model systems:

  • Cell line panels:

    • Test effects across diverse cancer types with varying TMEM160 expression levels

    • Include non-transformed cells to assess potential toxicity

  • 3D organoid models:

    • More physiologically relevant than 2D culture

    • Can incorporate tumor-immune interactions

    • Allow for longer-term studies of TMEM160 manipulation

  • In vivo models:

    • Immunodeficient xenograft models for human cancer cell studies

    • Immune-competent syngeneic models to study immune effects

    • Genetically engineered mouse models for studying TMEM160 in tumor development

Results from animal models show that TMEM160 knockdown significantly restricts tumor growth in both immunodeficient NOD-SCID mice and immune-competent BALB/c mice , supporting further therapeutic development.

How might TMEM160 status be assessed as a potential biomarker?

TMEM160 shows potential as a biomarker based on clinical correlations . Methodological considerations include:

  • Standardized immunohistochemistry protocols:

    • Categorize TMEM160 expression using the H-score method:

      • Staining intensity (negative, weak, intermediate, strong)

      • Density of positive cells (0-4 scale based on percentage)

      • Calculate H-score = (% positive cells)(0-4) × (staining intensity)(0-3)

      • Define cutoffs: H-score 0-4 as TMEM160-low, 5-12 as TMEM160-high

  • Multiplex immunohistochemistry:

    • Simultaneously assess TMEM160, PD-L1, and CD8+ T cell markers

    • Better characterize the tumor immune microenvironment

  • Combined biomarker approach:

    • Integrate TMEM160 status with established biomarkers

    • Develop predictive models for treatment response

Current data suggest TMEM160 has potential as both a prognostic marker for patient outcomes and a predictive biomarker for response to radiotherapy or immunotherapy .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.