Recombinant Human Transmembrane protein 169 (TMEM169)

Shipped with Ice Packs
In Stock

Description

General Information

Transmembrane protein 169 (TMEM169) is a protein found in humans and encoded by the TMEM169 gene . This gene is located on human chromosome 2q35 . Research indicates that TMEM169 is highly expressed in the nervous system .

Role in Neurological Development and Disorders

Studies on mice have shown that the Tmem169 protein interacts with neuronal proteins involved in neurodevelopmental diseases and promotes the development of neuronal processes and synapses through interaction with Shank3 . When the Tmem169 gene is deleted in the male mouse dorsal forebrain, it results in neuronal morphological abnormalities and synaptic dysfunction . Tmem169-deficient mice, regardless of sex, exhibit behavioral traits similar to those seen in individuals with autism .

Involvement in Cancer

TMEM165, a protein with a similar name, is also a transmembrane protein but is distinct from TMEM169. TMEM165 is a Golgi protein that functions in ion homeostasis and vesicular trafficking . TMEM165 is overexpressed in hepatocellular carcinoma (HCC), and its depletion weakens the invasive activity of cancer cells by suppressing matrix metalloproteinase-2 (MMP-2) expression . TMEM165 expression is associated with high levels of α-fetoprotein, macroscopic vascular invasion, and serosal invasion .

Expression Regulation

Several substances can affect TMEM169 expression. The following list provides examples of substances that have been shown to alter TMEM169 mRNA expression levels in rats:

  • beta-lapachone decreases expression

  • bis(2-ethylhexyl) phthalate decreases expression

  • bisphenol A decreases expression

  • cadmium dichloride decreases expression

  • copper atom increases expression

  • copper(0) increases expression

  • Cuprizon decreases expression

  • Dibutyl phosphate affects expression

  • dorsomorphin multiple interactions

  • perfluorooctane sulfonic acid co-treated with Pectins increases expression

  • phenylmercury acetate decreases expression

  • phenylmercury acetate multiple interactions

  • trichloroethene increases expression

  • trichostatin A increases or affects expression

  • triphenyl phosphate affects expression

  • triptonide decreases expression

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, specific format requests should be noted during order placement to ensure fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Products are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, briefly centrifuge the vial to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please specify this during your order; we will prioritize its inclusion.
Synonyms
TMEM169; Transmembrane protein 169
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-297
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
TMEM169
Target Protein Sequence
MEEPTAVEGQVQLPSPHQGSLRKAVAAALALDGESTMGHRKKKRKESRPESIIIYRSDNE KTDEEPGESEGGDQPKEEEGDDFLDYPVDDDMWNLPLDSRYVTLTGTITRGKKKGQMVDI HVTLTEKELQELTKPKESSRETTPEGRMACQMGADRGPHVVLWTLICLPVVFILSFVVSF YYGTITWYNIFLVYNEERTFWHKISYCPCLVLFYPVLIMAMASSLGLYAAVVQLSWSWEA WWQAARDMEKGFCGWLCSKLGLEDCSPYSIVELLESDNISSTLSNKDPIQEVETSTV
Uniprot No.

Target Background

Database Links

HGNC: 25130

KEGG: hsa:92691

UniGene: Hs.334916

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the genomic organization of the TMEM169 gene?

The TMEM169 gene spans 20,918 bases (216,081,866-216,102,783) on the positive strand of chromosome 2q35 and contains four exons . The gene's promoter (GXP_6745619) is 1242 base pairs at coordinates 216080866-216082107 . The TMEM169 gene produces five alternatively spliced variants generating four transcript variants, though all encode the same protein . The direct neighboring genes include XRCC5 (X-ray repair cross complementing 5) and PECR (peroxisomal trans-2-enoyl-CoA reductase) .

How is TMEM169 expressed in different tissues and developmental stages?

TMEM169 shows highest expression in the brain, particularly in the fetal brain, suggesting its importance during neurodevelopment . This expression pattern correlates with its proposed function in neuronal development and synapse formation. The strong expression in fetal brain tissue highlights its potential role in early brain development processes, which aligns with findings that link TMEM169 dysfunction to neurodevelopmental disorders like autism spectrum disorder .

How evolutionarily conserved is TMEM169 across species?

TMEM169 demonstrates significant evolutionary conservation across diverse taxonomic groups, with homologs identified in mammals, reptiles, amphibians, birds, fish, chordates, and invertebrates . The gene has been specifically identified in the Cape elephant shrew (Elephantulus edwardii) , and the most distantly related homolog has been found in Anopheles albimanus (a mosquito species) . This high degree of conservation suggests TMEM169 likely serves a fundamental biological function that has been maintained throughout evolution.

What experimental methodologies are commonly used to study TMEM169?

Various experimental approaches can be employed to study TMEM169, including:

MethodologyApplicationTechnical Considerations
Gene knockout modelsFunctional analysis in vivoMouse models with cortex-specific deletion show neuromorphological and behavioral phenotypes
Interaction assaysProtein-protein interaction studiesDemonstrated interactions with Shank3 and other neuronal proteins
Expression analysisTissue and developmental profilingHighest expression detected in fetal brain tissue
Transmembrane domain analysisStructural characterizationMethods like ToxR assay can determine transmembrane interactions
Scanning mutagenesisIdentification of critical functional residuesSystematic substitution with alanine or isoleucine to identify key residues

What is the proposed function of TMEM169 in neuronal development?

Recent research indicates that TMEM169 plays a crucial role in neuronal development and synaptic function. Studies demonstrate that TMEM169 promotes neuronal process and synapse development primarily through its interaction with Shank3, a key scaffolding protein at synapses . Deletion of Tmem169 in the mouse dorsal forebrain results in neuronal morphological abnormalities and synaptic dysfunction . The high expression of TMEM169 in the fetal brain further supports its developmental role .

The protein appears to be involved in critical neurodevelopmental processes including:

  • Neuronal morphology regulation

  • Synapse formation and maintenance

  • Potential roles in neuronal circuit establishment

These functions appear to be mediated through protein-protein interactions with established synaptic proteins, particularly Shank3, which is known to be involved in organizing the postsynaptic density .

What is the relationship between TMEM169 and neurodevelopmental disorders?

TMEM169 has emerging connections to neurodevelopmental disorders, particularly autism spectrum disorder (ASD). Variations on chromosome 2q, where TMEM169 is located (2q35), have been linked to autism, though specific genes responsible had not been previously characterized . Recent research demonstrates that Tmem169-deficient mice display behavioral traits resembling those observed in individuals with autism, regardless of sex .

The molecular pathway connecting TMEM169 to neurodevelopmental disorders appears to involve its interaction with Shank3, a well-established autism risk gene . This interaction suggests a mechanistic link between TMEM169 dysfunction and autism pathophysiology, as Shank3 is crucial for proper synapse development and function.

The study published in February 2025 represents the first characterization of TMEM169 in this context, identifying it as a previously uncharacterized gene that may contribute to autism etiology .

How can researchers effectively express and purify recombinant TMEM169?

Expressing and purifying transmembrane proteins like TMEM169 presents several technical challenges. Based on approaches used for similar transmembrane proteins:

Expression SystemAdvantagesLimitationsConsiderations for TMEM169
E. coliCost-effective, high yieldOften forms inclusion bodiesMay require fusion tags and refolding protocols
Yeast (P. pastoris)Post-translational modifications, membrane integrationLonger expression timeCodon optimization may improve yields
Insect cellsBetter folding, higher yields than mammalian cellsMore complex than bacterial systemsGood compromise for transmembrane domains
Mammalian cellsMost native-like folding and modificationsLower yields, higher costMay be necessary for functional studies

For purification, consider:

  • Detergent selection is critical - mild non-ionic detergents (DDM, LMNG) often preserve structure

  • Two-step purification typically required (affinity chromatography followed by size exclusion)

  • Protein quality assessment through thermal stability assays and circular dichroism

  • Consider native lipid nanodiscs for maintaining native environment

When designing constructs, the cytoplasmic domains (N and C termini) offer potential fusion points that may be less disruptive to protein structure than modifications to the transmembrane regions .

What approaches are optimal for studying TMEM169 transmembrane domain interactions?

Studying transmembrane domain (TMD) interactions of proteins like TMEM169 requires specialized techniques. Based on established methodology:

The ToxR assay represents an effective approach for investigating TMEM169 TMD interactions. This technique has been successfully applied to determine interfaces of various self-interacting TMDs . In this assay, the TMD of interest is fused to the ToxR transcription activator and MalE domains, allowing for measurement of TMD-TMD interactions through reporter gene expression .

For comprehensive characterization, scanning mutagenesis should be performed by systematically substituting residues within the TMD with alanine or isoleucine. This approach can identify specific residues critical for TMD-TMD interactions . Research demonstrates that interfacial residues of homotypic TMD-TMD interfaces tend to be more conserved, coevolved, and polar than non-interfacial residues . Additionally, interface positions are typically deficient in β-branched residues and often contain GxxxG motifs .

Other complementary methods include:

  • FRET-based approaches for measuring proximity between labeled TMDs

  • Cross-linking studies for capturing transient interactions

  • NMR spectroscopy for atomic-level resolution

  • Molecular dynamics simulations for computational insights

How does TMEM169 interact with Shank3 and other neuronal proteins?

TMEM169 has been demonstrated to interact with Shank3, a key scaffolding protein at excitatory synapses . This interaction appears to be crucial for TMEM169's role in promoting neuronal process and synapse development . The finding that TMEM169 interacts with Shank3 is particularly significant because Shank3 is a well-established autism risk gene, providing a molecular link between TMEM169 and neurodevelopmental disorders.

While the specific binding domains and interaction mechanisms are still being characterized, the functional consequences of this interaction include:

  • Promotion of neuronal process development

  • Enhancement of synapse formation

  • Potential modulation of synaptic signaling pathways

Research also indicates that TMEM169 interacts with several other key neuronal proteins implicated in neurodevelopmental diseases , though these additional partners require further investigation. Understanding these protein-protein interactions is crucial for elucidating TMEM169's functions in neuronal development and synaptic regulation.

What are the best experimental models for studying TMEM169 function?

For studying TMEM169 function, researchers should consider different model systems based on specific research questions:

Model TypeKey FeaturesResearch ApplicationsLimitations
Conditional knockout miceTissue-specific deletion in dorsal forebrainBehavioral phenotyping, neuronal morphology, synaptic functionTime-consuming generation, potential compensatory mechanisms
Primary neuronal culturesExtracted from knockout or wildtype animalsDetailed cellular morphology, synapse quantification, electrophysiologyLimited lifespan, restricted to ex vivo analysis
Human iPSC-derived neuronsHuman genetic background, potential for patient-specific variantsDisease modeling, drug screening, human-specific functionVariability between lines, lengthy differentiation protocols
Heterologous expression systemsControlled expression of wild-type or mutant TMEM169Protein-protein interactions, trafficking studiesMay not recapitulate native neuronal environment

Recent research has primarily utilized mouse models with cortex-specific Tmem169 deficiency, which have proven valuable for investigating the role of TMEM169 in neuronal development and function . These conditional knockout strategies targeting the dorsal forebrain have allowed researchers to observe neuronal morphological abnormalities and synaptic dysfunction resulting from Tmem169 deletion .

What considerations are important when designing antibodies against TMEM169?

Designing effective antibodies against transmembrane proteins like TMEM169 requires careful consideration of several factors:

  • Epitope Selection:

    • Prioritize cytoplasmic domains (N and C termini) which are more accessible and less hydrophobic

    • Avoid transmembrane domains (amino acids 160-180 and 211-231) as they are typically embedded in the membrane

    • Consider peptide regions with high predicted antigenicity and surface exposure

  • Antibody Format Considerations:

    • Monoclonal antibodies: Higher specificity but more resource-intensive to develop

    • Polyclonal antibodies: Broader epitope recognition but potential for cross-reactivity

    • Recombinant antibodies: Consistent production and potential for engineering

  • Validation Strategies:

    • Use knockout/knockdown models as negative controls

    • Perform peptide competition assays to confirm specificity

    • Validate across multiple applications (WB, IF, IP) if intended for diverse uses

    • Test in both overexpression systems and with endogenous protein

  • Special Considerations for TMEM169:

    • Given its high expression in brain tissue, validate in neural preparations

    • Consider cross-reactivity with other transmembrane proteins, particularly those with similar topologies

    • Test fixation and permeabilization protocols carefully for immunofluorescence applications

How can CRISPR/Cas9 be optimized for TMEM169 gene editing in experimental models?

Optimizing CRISPR/Cas9 for TMEM169 gene editing requires careful consideration of several technical aspects:

  • Guide RNA Design:

    • Target early exons (particularly exons 1-2) to ensure functional knockout

    • Consider targeting regions encoding functional domains (transmembrane domains at aa 160-180 or 211-231)

    • Evaluate off-target potential using prediction algorithms

    • Design multiple guide RNAs and validate cutting efficiency

  • Delivery Methods for Neuronal Applications:

    Delivery MethodAdvantagesLimitationsTMEM169-Specific Considerations
    AAV vectorsEfficient neuronal transduction, can target specific brain regionsLimited cargo capacityMay require split-Cas9 approach due to size
    Lentiviral vectorsLarger cargo capacity, stable integrationSafety concerns, more random targetingGood for in vitro neuronal studies
    ElectroporationEffective for neural progenitorsLimited to accessible cell populationsUseful for embryonic manipulations
    Lipid nanoparticlesReduced immunogenicity, non-viralLower efficiency in neuronsMay require neuronal targeting moieties
  • Validation Approaches:

    • Genomic: T7E1 assay, sequencing of target region

    • Transcriptomic: RT-PCR across edited region, RNA-seq

    • Protein: Western blot (if antibodies available)

    • Functional: Assess interaction with Shank3, examine neuronal morphology

  • Temporal Considerations:

    • Given TMEM169's high expression in fetal brain, developmental timing of editing is crucial

    • Consider inducible systems for temporal control of gene editing

What methodologies are most effective for visualizing TMEM169 subcellular localization?

Visualizing TMEM169 subcellular localization requires techniques optimized for membrane proteins:

  • Fluorescent Protein Tagging:

    • Position tags at cytoplasmic N or C terminus to minimize interference with transmembrane domains

    • Validate that fusion proteins maintain normal protein interactions (e.g., with Shank3)

    • Consider smaller fluorescent proteins (mNeonGreen, mEOS) to minimize functional disruption

    • Use both C and N-terminal fusions to confirm localization patterns

  • Advanced Microscopy Techniques:

    TechniqueResolutionApplications for TMEM169
    Confocal microscopy~200nmColocalization with synaptic markers
    STED super-resolution~30-70nmPrecise membrane localization, clustering analysis
    PALM/STORM~10-30nmSingle-molecule organization at synapses
    Expansion microscopyPhysical expansionVisualization within complex neuronal structures
  • Co-localization Analysis:

    • Synaptic markers: PSD-95, Bassoon, Synaptophysin

    • Membrane compartment markers: Early/late endosomes, ER, Golgi

    • TMEM169 interaction partners: Shank3 and other identified binding partners

  • Live-Cell Imaging Considerations:

    • Photobleaching approaches (FRAP) to assess protein mobility

    • Pulse-chase strategies to track protein trafficking

    • Time-lapse imaging during neuronal development to correlate with morphological changes

How can researchers investigate the role of TMEM169 in synaptic function?

Investigating TMEM169's role in synaptic function requires a multi-faceted approach combining molecular, cellular, and functional techniques:

  • Electrophysiological Approaches:

    • Whole-cell patch clamp recording to measure synaptic transmission in TMEM169-deficient neurons

    • Analysis of miniature excitatory postsynaptic currents (mEPSCs) to assess spontaneous synaptic activity

    • Paired recordings to evaluate specific synaptic connections

    • Field recordings to assess network-level effects

  • Molecular and Biochemical Analysis:

    • Co-immunoprecipitation to confirm and characterize Shank3 interaction in synaptic fractions

    • Synaptosome isolation to assess TMEM169 enrichment at synapses

    • Proximity labeling (BioID, APEX) to identify synaptic protein neighbors

    • Quantification of synaptic protein levels in TMEM169-deficient conditions

  • Imaging-Based Functional Analysis:

    ApproachApplicationTechnical Considerations
    Calcium imagingActivity-dependent calcium dynamicsUse GCaMP in TMEM169 WT vs. KO neurons
    FM dye uptake/releaseSynaptic vesicle cyclingAssess presynaptic function
    pH-sensitive reportersVesicle fusion and recyclingSypHy or pHluorin-based assays
    Live imaging of synaptic proteinsRecruitment dynamicsFluorescently tagged PSD proteins
  • Synapse Quantification:

    • Density of excitatory and inhibitory synapses in TMEM169-deficient neurons

    • Morphological classification of dendritic spines

    • Ultrastructural analysis using electron microscopy

    • Super-resolution analysis of synaptic protein organization

  • Behavioral Correlates:

    • Learning and memory tasks in conditional knockout models

    • Social interaction paradigms relevant to autism-like phenotypes

    • Analysis of repetitive behaviors

    • Sensory processing and integration assessment

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.