Recombinant Human Stimulator of interferon genes protein (STING1)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant STING1 is synthesized using advanced biotechnological methods:

ParameterDetails
Expression HostE. coli (e.g., Innov Research ) or HEK293T cells (OriGene )
TagsN-Sumo-6His (Innov Research), C-Myc/DDK (OriGene)
Purity>95% (SDS-PAGE verified)
Storage-20°C in PBS (pH 7.4) or Tris-glycine buffer with 10% glycerol
ActivityValidated in IFNβ reporter assays and protein interaction studies

Functional Characteristics

Recombinant STING1 retains native biological activities:

  • Immune Activation: Binds cyclic dinucleotides (e.g., cGAMP), oligomerizes, and recruits TBK1 to phosphorylate IRF3 or NF-κB, triggering IFN and cytokine production .

  • Autophagy Regulation: Promotes LC3 lipidation and autophagosome formation via non-canonical pathways .

  • Cell Death Modulation: Induces apoptosis, pyroptosis, or necroptosis depending on cellular context .

Applications in Research

Recombinant STING1 is widely used to study:

ApplicationKey Findings
Innate ImmunitySTING1 activation in brain endothelial cells drives IFNβ production during Plasmodium infection, exacerbating cerebral malaria .
Cancer ImmunotherapyAgonists targeting recombinant STING1 enhance antitumor T-cell responses .
Microbiome StudiesNuclear STING1 interacts with AHR to regulate gut microbiota homeostasis .
Drug DevelopmentUsed in high-throughput screens to identify STING1 inhibitors/activators .

Key Research Findings

StudyMethodologyOutcome
Heme-STING1 InteractionRecombinant STING1 incubated with hemeSTING1 binds heme, altering peroxidase activity and migration shift .
STING1-AHR CrosstalkCo-IP and luciferase assays in Sting1⁻/⁻ cellsNuclear STING1 activates AHR transcription independently of IFN pathways .
Lysosomal STING1 in Cell DeathPrimary monocyte modelsLysosomal STING1 triggers membrane permeabilization and cathepsin release .

Challenges and Limitations

  • Stability Issues: Requires storage at -20°C to prevent aggregation .

  • Functional Variability: Tag placement (e.g., N-Sumo vs. C-Myc) impacts interaction kinetics .

  • Immunogenicity: Bacterial-produced STING1 may contain endotoxins (<1.0 EU/µg) .

Future Directions

  • Therapeutic Targeting: Optimize STING1 agonists/antagonists for autoimmune diseases .

  • Structural Studies: Resolve full-length STING1 conformations to guide drug design .

  • Disease Models: Explore recombinant STING1 in neurodegenerative and metabolic disorders .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we currently have in stock. However, if you have any specific format requirements, please indicate them when placing your order. We will accommodate your needs.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We suggest briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
STING1; ERIS; MITA; TMEM173; Stimulator of interferon genes protein; hSTING; Endoplasmic reticulum interferon stimulator; Mediator of IRF3 activation; hMITA; Transmembrane protein 173
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-379
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MPHSSLHPSIPCPRGHGAQKAALVLLSACLVTLWGLGEPPEHTLRYLVLHLASLQLGLLL NGVCSLAEELRHIHSRYRGSYWRTVRACLGCPLRRGALLLLSIYFYYSLPNAVGPPFTWM LALLGLSQALNILLGLKGLAPAEISAVCEKGNFNVAHGLAWSYYIGYLRLILPELQARIR TYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTGDHAGIKDRVY SNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILA DAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTVGSLKTSAVPSTSTMSQE PELLISGMEKPLPLRTDFS
Uniprot No.

Target Background

Function
STING1 (Stimulator of interferon genes 1) is a crucial facilitator of innate immune signaling, acting as a sensor for cytosolic DNA derived from bacteria and viruses. It promotes the production of type I interferon (IFN-alpha and IFN-beta). Innate immune responses are triggered upon exposure to non-CpG double-stranded DNA from viruses and bacteria that enters the cytoplasm. STING1 binds cyclic dinucleotides, specifically recognizing and binding cyclic di-GMP (c-di-GMP), a bacterial second messenger, and cyclic GMP-AMP (cGAMP), a messenger produced by CGAS in response to DNA virus in the cytosol. Binding of c-di-GMP or cGAMP leads to STING1 oligomerization, translocation from the endoplasmic reticulum, and phosphorylation by TBK1 on the pLxIS motif. This phosphorylation facilitates the recruitment and subsequent activation of the transcription factor IRF3, inducing type I interferon expression and establishing a potent antiviral state. Beyond type I interferon production, STING1 directly contributes to autophagy. Following cGAMP binding, STING1 buds from the endoplasmic reticulum into COPII vesicles, forming the endoplasmic reticulum-Golgi intermediate compartment (ERGIC). The ERGIC serves as the membrane source for WIPI2 recruitment and LC3 lipidation, culminating in the formation of autophagosomes that target cytosolic DNA or DNA viruses for degradation by the lysosome. STING1's autophagy- and interferon-inducing activities can be uncoupled, with autophagy induction being independent of TBK1 phosphorylation. Autophagy is also triggered upon bacterial infection. Following c-di-GMP binding, which is produced by live Gram-positive bacteria, STING1 promotes reticulophagy. STING1 exhibits 2',3' phosphodiester linkage-specific ligand recognition, binding both 2'-3' linked cGAMP (2'-3'-cGAMP) and 3'-3' linked cGAMP. However, it is preferentially activated by 2'-3' linked cGAMP. This preference for 2'-3'-cGAMP over other linkage isomers is likely attributed to the ligand itself, which adopts an organized free-ligand conformation that resembles the STING1-bound conformation, requiring low energy costs to transition into the active conformation. STING1 may be involved in translocon function, potentially influencing type I interferon induction. It may also play a role in apoptotic signal transduction through its association with the major histocompatibility complex class II (MHC-II).

(Microbial infection) STING1's antiviral activity can be antagonized by oncoproteins such as papillomavirus (HPV) protein E7 and adenovirus early E1A protein. These oncoproteins impede STING1's ability to sense cytosolic DNA.
Gene References Into Functions
  1. We present physiological evidence that UBXN3B positively regulates stimulator-of-interferon genes (STING) signaling. Mechanistic studies demonstrate that UBXN3B interacts with both STING and its E3 ligase TRIM56, and facilitates STING ubiquitination, dimerization, trafficking, and consequent recruitment and phosphorylation of TBK1. PMID: 29899553
  2. STAG2 deficiency induces interferon responses via the cGAS-STING pathway and restricts virus infection. PMID: 29662124
  3. The STING-IRF3 pathway promotes hepatocyte injury and dysfunction by inducing inflammation and apoptosis, as well as by disrupting glucose and lipid metabolism. PMID: 29106945
  4. Data show that both cyclic GMP-AMP synthase (cGAS) and interferon-gamma inducible protein 16 (IFI16) are required for the activation of membrane protein STING (STING) and an innate immune response to exogenous DNA and DNA viruses. PMID: 28194029
  5. PUMA promotes the cytosolic release of mitochondrial DNA and activation of the DNA sensors DAI/Zbp1 and STING, leading to enhanced RIP3 and MLKL phosphorylation in a positive feedback loop. PMID: 29581256
  6. This study identified nitro-fatty acids as endogenously formed inhibitors of STING signaling and proposes these lipids to be considered in the treatment of STING-dependent inflammatory diseases. PMID: 30061387
  7. Cells of human individuals carrying HAQ TMEM173, which encodes a common hypomorphic variant of STING, were largely or partly defective in inducing type I IFNs and proinflammatory cytokines upon infection. PMID: 29263110
  8. Our studies indicate that the extracellular vesicles (EVs) released by HSV-1-infected cells carry innate immune components such as STING and other host and viral factors. These EVs can activate innate immune responses in recipient cells and inhibit HSV-1 replication. The implication of these data is that the EVs released by HSV-1-infected cells could control HSV-1 dissemination, promoting its persistence in the host. PMID: 29976662
  9. Data demonstrate that numerous RNA viruses evade cGAS/STING-dependent signaling and affirm the importance of this pathway in shaping the host range of ZIKV. PMID: 29915078
  10. Immune activation of STING requires palmitoylation at the Golgi. PMID: 27324217
  11. In the Title. PMID: 27554814
  12. This study demonstrated that HSV-1 tegument protein VP22 counteracts the cGAS/STING-mediated DNA-sensing antiviral innate immunity signaling pathway by inhibiting the enzymatic activity of cGAS. PMID: 29793952
  13. An electrophoretic mobility shift assay showed that signal transducers and activators of transcription 1 (STAT1) attach to the GAS motif on the human STING promoter region. This indicates that IFN-gamma/Janus kinases/STAT1 signaling is essential for the STING upregulation in human keratinocytes. PMID: 29143896
  14. The cGAS-STING cascade contributes to antibacterial defense against L. pneumophila in mice and men, and provides important insight into how the common HAQ TMEM173/STING variant affects antimicrobial immune responses and susceptibility to infection. PMID: 29298342
  15. Pharmacological activation of STING in macrophages and hepatocytes induces host innate responses that can efficiently control hepatitis B virus replication. Hence, despite not playing a significant role in host innate immune response to HBV infection of hepatocytes, STING is potentially a valuable target for immunotherapy of chronic hepatitis B. PMID: 28717041
  16. This study summarizes recent findings that have pointed towards the STING pathway as an innate immune sensing mechanism driving type I interferon production in the tumor context PMID: 28639100
  17. This review summarizes important features of the STING activation pathway and recent highlights about the role of STING in bacterial infections by Chlamydia, Listeria, Francisella, Brucella, Shigella, Salmonella, Streptococcus, and Neisseria genera, with a special focus on mycobacteria. PMID: 28625530
  18. STING serves to detect - and promote immune defense against - DNA viruses and intracellular bacteria, as described in its initial discovery. The role of STING has since been expanded to include tumor surveillance and immune responses to cancer; indeed, defective STING responses are associated with certain cancers. PMID: 28724326
  19. C11 depends on signaling through STING to produce antiviral type I interferon, which further supports its potential as a therapeutic drug or research tool. PMID: 29263267
  20. This study demonstrates that the HCMV tegument protein pp65 inhibits IFN-beta production by binding and inactivating cGAS early during infection. In addition, this inhibitory activity specifically targets cGAS, since it can be bypassed via the addition of exogenous cGAMP, even in the presence of pp65. Notably, STING proteasome-mediated degradation was observed in both the presence and absence of pp65. PMID: 29263269
  21. The DNA binding domain of Ku70 was essential for formation of the Ku70-STING complex. Knocking down STING in primary human macrophages inhibited their ability to produce IFN-lambda1 in response to transfection with DNA or infection with the DNA virus HSV-2 (herpes simplex virus-2); STING mediates the Ku70-mediated IFN-lambda1 innate immune response to exogenous DNA or DNA virus infection. PMID: 28720717
  22. Data show that human cytomegalovirus (HCMV; human betaherpesvirus 5) glycoprotein US9 inhibits the IFN-beta response by targeting the mitochondrial antiviral-signaling protein (MAVS) and stimulator of interferon genes (STING)-mediated signaling pathways. PMID: 29317664
  23. In the current study, we studied the role of MITA (Mediator of IRF3 Activation), a regulator of innate immunity, in the regulation of autophagy and its implication in cell death of breast cancer cells. Here, we report that MITA inhibits the fusion of autophagosome with lysosome as evident from different autophagy flux assays PMID: 28366813
  24. These studies demonstrate that transcription factors CREB and c-Myc maintain the transcriptional activity of STING PMID: 27835584
  25. TheTREX1 and STING, which are opposing regulators of the cytosolic DNA-sensing pathway. PMID: 28475463
  26. STING-regulated pathways underlie the pathogenesis of many diseases including infectious diseases and cancers. It has also become evident from these studies that STING is a promising therapeutic target for the treatment of cancer. PMID: 26980676
  27. Using a murine HNSCC model that does not express STING, we demonstrate that STING ligands are an effective therapy regardless of expression of STING by the cancer cells PMID: 29135982
  28. Human T-lymphotropic virus 1 Tax protein impairs K63-linked ubiquitination of STING and disrupted the interactions between STING and TBK1 to evade host innate immunity. PMID: 28119118
  29. STING activated an antiviral/type I interferon response with live but not killed S. aureus. PMID: 28704551
  30. This study identifies the AIM2 inflammasome and cGAS/IFI16-STING-type I IFN pathway as a novel mechanism for host innate immunity to the ALVAC vaccine vector. PMID: 28947539
  31. NEMO was critically involved in the cGAS-STING pathway. PMID: 28939760
  32. This study investigated the association of genetic variants of the MAVS, MITA and MFN2 genes with leprosy in Han Chinese from Southwest China; no association was found between the variants and susceptibility to leprosy. PMID: 27553710
  33. Both IL-6 and RIG-I are downstream molecules of STING along the DNA sensor pathway. PMID: 28806404
  34. Our data provide an important insight into STING-mediated induction of type I and III IFNs and subsequent antiviral signaling pathways that regulate VZV replication in human dermal cells. PMID: 28647346
  35. STING, a critical innate sensor, also functions intrinsically in cells of the adaptive immune system to inhibit proliferation. PMID: 28484079
  36. This study discusses three newly described monogenic autoinflammatory diseases [deficiency of adenosine deaminase 2 (DADA2), a subtype of macrophage activation syndrome (MAS), and stimulator of interferon genes (STING)-associated vasculopathy with onset in infancy (SAVI)], discusses the possibilities of somatic mosaicism and digenic inheritance, and gives an update on new concepts in pathways involved in familial Mediterranean fever PMID: 27362340
  37. Human Cytomegalovirus tegument protein UL82 negatively regulates STING-mediated signaling. PMID: 28132838
  38. Structural analysis indicates that the 3 disease-associated mutations at positions 206, 281, and 284 of the STING protein define a novel cluster of amino acids with functional importance in the regulation of type I interferon signaling PMID: 28087229
  39. This study revealed a critical role of p38-mediated USP21 phosphorylation in regulating STING-mediated antiviral functions and identifies the p38-USP21 axis as an important pathway that DNA virus adopts to avoid innate immunity responses. PMID: 28254948
  40. We conclude that the R71H-G230A-R293Q (HAQ) of TMEM173 is a null TMEM173 allele. PMID: 27927967
  41. The authors found that the herpes simplex virus 1 UL46 protein interacts with and colocalizes with STING. PMID: 28592536
  42. This study highlights essential roles of the cGAS-cGAMP-STING pathway. [review] PMID: 27706894
  43. These results suggest that pDCs sense cytosolic DNA and cyclic dinucleotides via the cGAS-STING pathway and that targeting this pathway could be of therapeutic interest. PMID: 27125983
  44. Human herpesvirus 1 ICP27 interacted with TBK1 and STING in a manner that was dependent on TBK1 activity and the RGG motif in ICP27 and inhibited type I IFN induction through the cGAS-STING-TBK1 pathway in human macrophages. PMID: 27234299
  45. Multivariate analysis supported TMEM173 as an independent prognostic factor. PMID: 27814372
  46. The mitochondrial damage-cGAS-STING-IRF3 pathway is critically involved in metabolic stress-induced endothelial inflammation. PMID: 28302626
  47. These data uncover a promycobacterial role for STING-dependent OASL production during Mycobacterium leprae infection that directs the host immune response toward a niche that permits survival of the pathogen. PMID: 27190175
  48. A heterozygous gain-of-function mutation in STING can cause familial chilblain lupus. PMID: 27566796
  49. cGAs recognizes bacterial/viral DNA, and is a strong activator of STING that can further activate IRF3 and subsequent type I interferon production. (Review) PMID: 27696330
  50. In the present study, the authors found that herpes simplex virus 1 tegument protein UL41 was involved in counteracting the cGAS/STING-mediated DNA-sensing pathway. PMID: 28077645

Show More

Hide All

Database Links

HGNC: 27962

OMIM: 612374

KEGG: hsa:340061

STRING: 9606.ENSP00000331288

UniGene: Hs.379754

Involvement In Disease
STING-associated vasculopathy, infantile-onset (SAVI)
Protein Families
TMEM173 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Cytoplasm, perinuclear region. Endoplasmic reticulum-Golgi intermediate compartment membrane; Multi-pass membrane protein. Cytoplasmic vesicle, autophagosome membrane; Multi-pass membrane protein. Mitochondrion outer membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Ubiquitously expressed. Expressed in skin endothelial cells, alveolar type 2 pneumocytes, bronchial epithelium and alveolar macrophages.

Q&A

What is the molecular structure and fundamental function of STING1?

STING1 (also known as TMEM173, MITA, ERIS, or MPYS) is a five-transmembrane protein primarily localized to the endoplasmic reticulum. It functions as a critical pattern recognition receptor that detects cytosolic nucleic acids, particularly cyclic dinucleotides such as bacterial cyclic di-GMP (c-di-GMP) and cGAMP produced by cGAS in response to cytosolic DNA . This protein serves as a central mediator in the innate immune response to viral and bacterial infections by activating type I interferon production. Additionally, STING1 plays direct roles in autophagy and can influence apoptotic signaling through association with MHC class II complexes .

How does STING1 transmit signals following activation?

Upon binding cyclic dinucleotides, STING1 undergoes conformational changes leading to oligomerization and translocation from the endoplasmic reticulum. It is subsequently phosphorylated by TBK1 on the pLxIS motif, which facilitates recruitment and activation of transcription factor IRF3 . Activated IRF3 then translocates to the nucleus, inducing expression of type I interferons and establishing an antiviral state. Following cGAMP binding, STING1 also buds from the endoplasmic reticulum into COPII vesicles, forming the endoplasmic reticulum-Golgi intermediate compartment (ERGIC) . This ERGIC functions as a membrane source for WIPI2 recruitment and LC3 lipidation, leading to autophagosome formation that targets cytosolic DNA or DNA viruses for lysosomal degradation .

What determines STING1 binding specificity for different cyclic dinucleotides?

STING1 exhibits 2',3' phosphodiester linkage-specific ligand recognition capabilities. While it can bind both 2'-3' linked cGAMP (2'-3'-cGAMP) and 3'-3' linked cGAMP, it preferentially activates in response to 2'-3' linked cGAMP . This preference appears to be related to the structural properties of 2'-3'-cGAMP, which naturally adopts a conformation resembling the STING1-bound state, requiring lower energy costs to transition into the active configuration. This structural compatibility enhances binding efficiency and subsequent signaling activity, making 2'-3'-cGAMP a more potent activator of STING1-mediated immune responses.

How do common human STING1 allelic variants differ functionally?

Human populations carry several STING1 variants with distinct functional characteristics:

The HAQ allele demonstrates reduced responsiveness to STING1 agonists and diminished ability to induce type I interferons . It confers resistance to STING1-mediated cell death at lower concentrations of STING1 agonists, potentially providing an evolutionary advantage by balancing immune protection against excessive inflammation.

The AQ variant exhibits an intermediate phenotype, permitting STING1-mediated IRF3 activation and type I interferon production while still conferring resistance to STING1-mediated cell death . This functional uncoupling between interferon response and cell death pathways demonstrates the distinct downstream mechanisms that can be activated by STING1.

The Q293 variant shows significantly reduced responsiveness, with no detectable activation of the STING1 pathway or induction of cell death even at high concentrations of agonists like diABZI . This further reveals the spectrum of functional variation present in human populations.

How does STING1 variation affect CD4 T cell populations in disease models?

STING1 genetic variation significantly impacts CD4 T cell populations in disease models. In STING-associated vasculopathy with onset in infancy (SAVI), patients with constitutively activated STING1 exhibit CD4 T cellpenia, a reduction in CD4 T cell numbers . Similarly, mouse models of SAVI demonstrate CD4 T cell depletion.

Remarkably, introducing the human HAQ or AQ STING1 alleles into SAVI mouse models rescues the CD4 T cell depletion and reduces mortality . This protective effect appears to stem from the reduced ability of these variant alleles to induce cell death in CD4 T cells while still permitting some interferon signaling (particularly with the AQ variant). These findings highlight the critical role of STING1 genetic variation in modulating disease severity and suggest potential therapeutic approaches for STING1-associated disorders.

What experimental methods are effective for characterizing STING1 variants?

To characterize STING1 variants effectively, researchers can employ multiple complementary approaches:

  • Genotyping assays:

    • Sequencing of the STING1 gene to identify specific polymorphisms

    • PCR-based assays targeting known variant loci (e.g., for HAQ, AQ, Q293 variants)

  • Functional characterization:

    • Phospho-IRF3 immunoblotting to measure downstream signaling activation

    • Type I interferon production assessment via ELISA or qRT-PCR

    • Cell death assays using flow cytometry with Annexin V/Propidium Iodide staining or other viability markers

  • Cellular response profiling:

    • Dose-response curves with STING1 agonists (e.g., diABZI, cGAMP)

    • Comparison of responses across different cell types (CD4 T cells, CD8 T cells, B cells)

    • Time-course experiments to capture both immediate and delayed effects

These methods, used in combination, can provide comprehensive characterization of how STING1 variants differ in their signaling capabilities, cell type-specific effects, and potential impacts on disease pathogenesis.

Why does STING1 activation selectively affect CD4 T cells?

STING1 activation exhibits a striking cell type-specific effect, with CD4 T cells being particularly vulnerable to STING1-mediated cell death compared to other lymphocyte populations. This selectivity has been demonstrated in multiple studies:

Human lung explant cells treated with STING1 agonists (diABZI and RpRpss-Cyclic di-AMP) show selective killing of CD4 T cells but not CD8 T cells or CD19+ B cells, even at high agonist concentrations (500 ng/ml) . This cell type specificity is paradoxical given that STING1 was initially characterized as an innate immune sensor yet has particularly high expression in CD4 T cells .

The mechanisms underlying this selectivity likely involve multiple factors:

  • Differential expression of components in cell death pathways

  • Cell type-specific trafficking or compartmentalization of STING1

  • Variations in threshold sensitivity to STING1-mediated signals

  • Differences in protective mechanisms against STING1-induced cellular stress

This selective vulnerability has significant clinical implications, as it explains the CD4 T cellpenia observed in SAVI patients and highlights the importance of considering cell type-specific effects when developing STING1-targeting therapeutics.

What are the distinct cell death pathways activated by STING1?

STING1-mediated cell death involves complex and potentially overlapping mechanisms. Multiple death pathways have been implicated in different cellular contexts:

  • Apoptosis: STING1 activation can lead to caspase-dependent apoptotic cell death, particularly in T cells .

  • Necroptosis: RIPK1/3-dependent necroptotic death has been reported following STING1 activation in certain cell types.

  • Pyroptosis: Inflammatory cell death involving caspase-1 activation and gasdermin D.

  • Ferroptosis: Iron-dependent cell death associated with lipid peroxidation.

  • PANoptosis: A comprehensive cell death program involving elements of multiple death pathways .

The specific pathway engaged appears to depend on the cell type, STING1 agonist concentration, and genetic factors. Importantly, STING1-mediated cell death is type I interferon-independent , as demonstrated by the continued susceptibility of cells to death even when interferon signaling is blocked. This independence from interferon signaling is further supported by the observation that the AQ STING1 variant permits interferon induction while protecting against cell death .

How can STING1-mediated cell death pathways be experimentally distinguished?

Distinguishing between different STING1-mediated cell death pathways requires a comprehensive experimental approach:

  • Morphological assessment:

    • Light and electron microscopy to observe cellular hallmarks of different death modalities

    • Live-cell imaging to track temporal dynamics of cell death progression

  • Biochemical markers:

    • Caspase activation assays (caspase-3/7 for apoptosis, caspase-1 for pyroptosis)

    • PARP cleavage detection for apoptosis

    • Phosphatidylserine externalization via Annexin V staining for early apoptosis

    • Propidium iodide uptake for plasma membrane permeabilization

    • MLKL phosphorylation for necroptosis

    • Gasdermin D cleavage for pyroptosis

    • Lipid peroxidation assays for ferroptosis

  • Genetic approaches:

    • Knockdown or knockout of pathway-specific components (e.g., caspases, RIPK1/3, GSDMD)

    • Expression of dominant-negative forms of death pathway proteins

    • Comparison between cells expressing different STING1 variants (HAQ, AQ)

  • Pharmacological inhibitors:

    • Pan-caspase inhibitors (Z-VAD-FMK) for apoptosis

    • Necrostatin-1 for necroptosis

    • Caspase-1 inhibitors for pyroptosis

    • Ferrostatin-1 for ferroptosis

By employing multiple complementary approaches, researchers can systematically identify the predominant death pathways activated by STING1 in specific cellular contexts and determine how these pathways interact or operate independently.

What are critical considerations for designing STING1 activation assays?

When designing STING1 activation assays, researchers should consider several critical factors:

  • STING1 variants and expression:

    • Account for natural STING1 variants (HAQ, AQ, Q293) that significantly affect response magnitude

    • Ensure appropriate expression levels through careful selection of expression systems

    • Include proper controls for each variant when making comparisons

  • Cell type selection:

    • Consider differential sensitivity of cell types (CD4 T cells vs. CD8 T cells vs. B cells)

    • Use relevant primary cells where possible, as cell lines may not recapitulate all aspects of STING1 biology

    • Match genetic backgrounds when comparing responses across different cell populations

  • Agonist selection and dosing:

    • Select appropriate STING1 agonists (cGAMP, diABZI, cyclic di-AMP) based on research question

    • Include dose-response analyses to identify thresholds for different downstream responses

    • Consider the specificity of agonists for STING1 versus other potential targets

  • Readout selection:

    • Measure multiple outputs (IRF3 phosphorylation, type I interferon production, cell death, autophagy)

    • Include time-course analyses to capture both immediate and delayed responses

    • Use appropriate controls for each readout to ensure specificity

  • Genetic controls:

    • Include STING1 knockout controls to confirm specificity of observed effects

    • Consider rescue experiments with wild-type or variant STING1 to confirm direct causality

These considerations help ensure robust, reproducible results that accurately reflect STING1 biology across different experimental contexts.

How can researchers optimize expression systems for recombinant STING1?

Optimizing expression systems for recombinant STING1 requires attention to several key aspects:

  • Expression vector selection:

    • Consider using vectors with inducible promoters to control expression levels

    • Select appropriate tags (His, FLAG, etc.) that don't interfere with STING1 function

    • Position tags strategically to avoid disrupting transmembrane domains or ligand-binding sites

  • Cell system selection:

    • Mammalian expression systems (HEK293, THP-1) provide appropriate post-translational modifications

    • Consider STING1-knockout cell lines for clean background when introducing variants

    • For stable expression, use selection markers (G418, puromycin) at appropriate concentrations

  • Transfection optimization:

    • For hard-to-transfect cells like THP-1, optimize lipofection conditions (Lipofectamine LTX)

    • Consider lentiviral or retroviral transduction for stable integration in difficult cell types

    • Validate expression levels by western blotting or flow cytometry

  • Functional validation:

    • Confirm ligand binding capability of recombinant STING1

    • Verify downstream signaling functionality (IRF3 phosphorylation, interferon induction)

    • Compare wild-type and variant forms (HAQ, AQ, Q293) to ensure expected functional differences

  • Purification considerations (for in vitro studies):

    • Use mild detergents that preserve STING1 structure for membrane protein extraction

    • Consider nanodiscs or detergent micelles to maintain transmembrane protein stability

    • Validate final protein conformation through ligand binding assays

These optimization steps ensure that recombinant STING1 accurately represents the native protein's structure and function, enabling reliable experimental outcomes.

What in vivo models are most appropriate for studying STING1 biology?

Selecting appropriate in vivo models for studying STING1 biology requires careful consideration of species differences and disease relevance:

  • Genetically modified mouse models:

    • STING1 knockout mice to study loss-of-function effects

    • STING1 N153S knock-in mice that model human SAVI disease

    • Human STING1 variant knock-in mice (HAQ, AQ) to study allelic effects

    • Conditional knockout models to study tissue-specific roles

  • Humanized systems:

    • Mice expressing human STING1 variants on a mouse STING1-null background

    • Humanized immune system mice to better reflect human-specific STING1 responses

    • Human explant systems (e.g., lung tissue) for ex vivo studies with human STING1

  • Disease-specific models:

    • SAVI disease models with constitutive STING1 activation

    • Cancer models for studying STING1-mediated anti-tumor immunity

    • Infectious disease models to study STING1's role in pathogen defense

  • Analytical considerations:

    • Multi-parameter flow cytometry to assess immune cell populations and activation status

    • Histopathological examination to evaluate tissue-specific effects (e.g., lung inflammation)

    • Measurement of systemic interferon levels and interferon-stimulated gene expression

    • Longitudinal studies to capture disease progression and mortality differences

The search results highlight the utility of human STING1 variant knock-in mouse models for assessing the impact of genetic variation on STING1 function in vivo . These models have revealed that common human STING1 variants (HAQ, AQ) can rescue CD4 T cellpenia and reduce mortality in SAVI mouse models, providing valuable insights into how genetic variation modulates disease outcomes.

How do STING1 mutations contribute to SAVI pathogenesis?

STING-associated vasculopathy with onset in infancy (SAVI) is caused by gain-of-function mutations in the STING1 gene that lead to constitutive activation of the protein . The pathogenesis of SAVI involves multiple mechanisms:

  • Constitutive interferon production:

    • STING1 mutations (such as N153S) cause ligand-independent activation

    • This leads to chronic type I interferon production and interferon-stimulated gene expression

    • The resulting "interferon signature" drives systemic inflammation

  • CD4 T cell depletion:

    • SAVI patients typically present with CD4 T cellpenia

    • This depletion appears to result from STING1-mediated cell death of CD4 T cells

    • The CD4 T cell death is independent of type I interferon signaling

  • Vascular and tissue inflammation:

    • Excessive interferon signaling promotes vascular inflammation

    • Affected patients develop interstitial lung disease, joint inflammation, and skin lesions

    • The inflammatory process can lead to severe tissue damage and fibrosis

  • Genetic modifiers:

    • The severity of SAVI may be influenced by additional genetic factors

    • Common STING1 variants like HAQ and AQ can modulate disease phenotypes when present alongside pathogenic mutations

    • These variants can rescue CD4 T cellpenia and reduce mortality in mouse models

Understanding these pathogenic mechanisms is crucial for developing targeted therapies for SAVI patients, including potential approaches to preserve CD4 T cell populations or modulate STING1 activity.

What are the potential applications and risks of STING1 agonists in cancer immunotherapy?

STING1 agonists represent a promising approach for cancer immunotherapy, but their development has revealed important safety considerations:

Potential applications:

  • Direct tumor cell killing through STING1-mediated cell death pathways

  • Activation of innate immune responses against tumors via type I interferon induction

  • Enhancement of adaptive anti-tumor immunity through improved antigen presentation

  • Conversion of immunologically "cold" tumors to "hot" immunogenic tumors

  • Combination therapy with immune checkpoint inhibitors or other immunotherapeutics

Safety considerations:

  • Clinical trials with STING1 agonists have encountered significant adverse events

    • Grade 3/4 treatment-related adverse events reported in 12.2% of patients in one trial (NCT02675439)

    • A Grade 5 (fatal) serious adverse event was recorded in a trial using STING1 antibody-drug conjugate (NCT05514717)

  • STING1 genetic variation impacts response and toxicity:

    • Common STING1 variants (HAQ, AQ, Q293) show differential responses to STING1 agonists

    • These genetic variations may significantly influence both efficacy and safety in patients

These findings highlight the critical importance of considering STING1 genotype in clinical trial design to achieve safe and effective responses . Personalized approaches based on patient genotyping could help optimize dosing regimens and identify patients most likely to benefit from STING1-targeting therapies while minimizing toxicity risks.

How might STING1 genetic variation impact therapeutic responses?

STING1 genetic variation has profound implications for therapeutic responses to both STING1 agonists and potentially other immunomodulatory agents:

  • Impact on agonist sensitivity:

    • The HAQ variant shows reduced responsiveness to STING1 agonists, requiring higher doses for activation

    • The AQ variant permits interferon induction but resists cell death, potentially altering therapeutic outcomes

    • The Q293 variant shows minimal responsiveness even at high agonist concentrations

  • Differential pathway activation:

    • Variants like AQ demonstrate uncoupled pathways, activating interferon production without inducing cell death

    • This pathway selectivity could be leveraged for more targeted therapeutic approaches

  • Clinical implications:

    • STING1 genotyping could predict patient responses to STING1-targeting therapeutics

    • Dosing adjustments based on genotype might improve safety profiles while maintaining efficacy

    • The protective effects of HAQ and AQ alleles in SAVI mouse models suggest potential therapeutic approaches

  • Population considerations:

    • The STING1 gene appears to have undergone natural selection during human migration events

    • Population-specific STING1 variant distributions may affect clinical trial outcomes in different regions

This genetic landscape suggests that a precision medicine approach incorporating STING1 genotyping could significantly improve outcomes for therapeutics targeting this pathway. Future clinical trials should stratify patients based on STING1 genotype to better understand efficacy and safety profiles across different genetic backgrounds.

How are STING1-mediated autophagy and interferon pathways mechanistically uncoupled?

The uncoupling of STING1-mediated autophagy and interferon pathways represents a fascinating aspect of STING1 biology:

  • Differential requirements for TBK1:

    • STING1-induced autophagy occurs independently of TBK1 phosphorylation

    • In contrast, interferon induction requires TBK1-mediated phosphorylation of STING1 and subsequent IRF3 activation

  • Compartment-specific signaling:

    • Following cGAMP binding, STING1 buds from the endoplasmic reticulum into COPII vesicles, forming the ERGIC

    • The ERGIC serves as a membrane source for autophagosome formation through WIPI2 recruitment and LC3 lipidation

    • Interferon signaling may initiate at different compartments during STING1 trafficking

  • Genetic evidence of pathway uncoupling:

    • The AQ STING1 variant permits IRF3 activation and type I interferon production while protecting against cell death

    • This genetic dissociation provides strong evidence for distinct downstream pathways

  • Structural determinants:

    • Different conformational states of STING1 may preferentially engage either autophagy or interferon machinery

    • Specific domains or residues within STING1 likely have differential roles in activating these distinct pathways

Understanding these uncoupled mechanisms could enable the development of more selective STING1-targeting therapeutics that preferentially activate beneficial responses while minimizing unwanted effects.

What are emerging techniques for studying STING1 conformational dynamics?

Studying STING1 conformational dynamics requires sophisticated techniques to capture the protein's structural changes upon activation:

  • Cryo-electron microscopy (cryo-EM):

    • Enables visualization of STING1 in different conformational states

    • Can capture oligomeric structures formed upon ligand binding

    • Provides near-atomic resolution of protein complexes in their native states

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Identifies regions of STING1 that undergo conformational changes upon ligand binding

    • Maps protection patterns that reveal structural rearrangements

    • Captures dynamics that may be missed in static structural studies

  • Single-molecule FRET (smFRET):

    • Monitors real-time conformational changes in individual STING1 molecules

    • Can detect transient intermediates in the activation process

    • Allows correlation between structural changes and functional outcomes

  • Molecular dynamics simulations:

    • Models the dynamic behavior of STING1 in different environments

    • Predicts conformational transitions upon ligand binding

    • Identifies potential allosteric communication networks within the protein

  • Native mass spectrometry:

    • Characterizes STING1 oligomerization states under different conditions

    • Preserves non-covalent interactions critical for function

    • Determines stoichiometry of protein-ligand complexes

These advanced techniques, used in combination, can provide comprehensive insights into how STING1 undergoes the structural transformations necessary for signaling and how these changes differ between wild-type STING1 and its variants like HAQ, AQ, and Q293.

What cellular factors determine the cell type-specific effects of STING1 activation?

The remarkable cell type-specific effects of STING1 activation, particularly the selective vulnerability of CD4 T cells to STING1-mediated death, likely involve multiple cellular determinants:

  • Expression levels of pathway components:

    • Differential expression of downstream effectors in the cell death machinery

    • Variations in protective pathways that counteract STING1-induced stress

    • Balance between pro-survival and pro-death factors in different cell types

  • Subcellular organization and trafficking:

    • Cell type-specific differences in ER, Golgi, and ERGIC compartmentalization

    • Variations in vesicular trafficking machinery affecting STING1 movement

    • Differential association with organelles critical for STING1 function

  • Metabolic context:

    • Cell type-specific metabolic programs that influence sensitivity to STING1-induced stress

    • Mitochondrial dynamics and their impact on cell death thresholds

    • Energy status and its effect on stress response capabilities

  • Signaling network architecture:

    • Differences in feedback regulation mechanisms between cell types

    • Variations in cross-talk between STING1 and other immune signaling pathways

    • Cell type-specific signal integration and threshold responses

  • Genetic factors:

    • The influence of STING1 variants (HAQ, AQ) on cell type-specific responses

    • Additional genetic modifiers that interact with STING1 signaling

    • Epigenetic regulation affecting STING1 pathway components

Understanding these determinants would provide valuable insights for therapeutic targeting of STING1, potentially allowing for interventions that preserve beneficial immune functions while preventing pathological outcomes like CD4 T cell depletion in SAVI and other inflammatory conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.