Recombinant Human Transmembrane protein 176B (TMEM176B)

Shipped with Ice Packs
In Stock

Description

Table 1: Recombinant TMEM176B Variants

Catalog No.Host SystemTagPurityApplicationsSource
ABIN7125483E. coliHis-IF2DI>95%ELISA, WB
-Wheat germGST-ELISA, WB, AP
-TobaccoStrep Tag>80%SDS-PAGE, SEC, WB

Cancer Progression

TMEM176B is implicated in multiple cancers:

  • Colorectal Cancer (CRC): Silencing TMEM176B inhibits metastasis and epithelial-mesenchymal transition (EMT) by suppressing NLRP3 inflammasome activation .

  • Triple-Negative Breast Cancer (TNBC): Overexpression enhances tumor growth via AKT/mTOR signaling, while silencing reduces proliferation and migration .

  • Lung Adenocarcinoma: Promotes EMT through FGFR1/JNK/Vimentin/Snail signaling, correlating with poor prognosis .

Table 2: TMEM176B in Cancer Models

Cancer TypeMechanism of ActionTherapeutic Effect of Silencing/InhibitionCitation
ColorectalNLRP3 inflammasome suppressionReduced metastasis, enhanced apoptosis
BreastAKT/mTOR pathway activationImpaired proliferation, tumor growth inhibition
LungFGFR/JNK-mediated EMTDecreased invasion, adhesion, and angiogenesis

Immune Regulation

  • Inflammasome Activation: TMEM176B acts as an innate immune checkpoint by repressing NLRP3 inflammasome activity. Genetic disruption enhances CD8+ T cell-mediated antitumor responses .

  • Dendritic Cell Maturation: Expressed in immature dendritic cells (DCs), where it regulates endosomal acidification and antigen presentation .

Therapeutic Potential

  • Antibody Targeting: Anti-TMEM176B antibodies inhibit proliferation in TNBC cells and reduce tumor growth in xenograft models .

  • Combination Therapy: Synergizes with anti-CTLA-4/PD-1 checkpoint inhibitors by unleashing inflammasome-driven immunity .

Research Applications

  • Biochemical Assays: Used in ELISA, Western blotting, and protein interaction studies (e.g., binding to TMEM176A and CPXM1) .

  • In Vivo Models: Employed in syngeneic and xenograft tumor studies to evaluate oncogenic pathways .

Clinical Relevance

  • Prognostic Marker: High TMEM176B expression correlates with advanced TNM stages in colorectal and lung cancers .

  • Immune Microenvironment: Linked to T cell activation and cytokine profiles (e.g., IL-18, TGF-β) in tumor contexts .

Production and Validation

  • Expression Systems: Commonly produced in E. coli, tobacco (Nicotiana tabacum), and wheat germ .

  • Quality Control: Validated via SDS-PAGE (>95% purity), analytical SEC, and functional assays (e.g., inflammasome activity tests) .

Key Challenges and Future Directions

  • Mechanistic Complexity: Dual roles in immune activation vs. cancer progression require context-specific targeting strategies.

  • Therapeutic Optimization: Developing isoform-specific inhibitors to minimize off-target effects .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we understand your specific requirements. If you need a particular format, please indicate your preference when placing the order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for precise delivery information.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
TMEM176B; LR8; Transmembrane protein 176B; Protein LR8
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-270
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
TMEM176B
Target Protein Sequence
MTQNTVIVNGVAMASRPSQPTHVNVHIHQESALTQLLKAGGSLKKFLFHPGDTVPSTARI GYEQLALGVTQILLGVVSCVLGVCLSLGPWTVLSASGCAFWAGSVVIAAGAGAIVHEKHP GKLAGYISSLLTLAGFATAMAAVVLCVNSFIWQTEPFLYIDTVCDRSDPVFPTTGYRWMR RSQENQWQKEECRAYMQMLRKLFTAIRALFLAVCVLKVIVSLVSLGVGLRNLCGQSSQPL NEEGSEKRLLGENSVPPSPSREQTSTAIVL
Uniprot No.

Target Background

Function
TMEM176B may play a role in the maturation process of dendritic cells. It is also essential for the development of cerebellar granule cells.
Gene References Into Functions
  1. This study characterized Tmem176a and b expression in RORgamma t+ lymphocytes at both transcriptional and protein levels, providing evidence that both genes perform a redundant ion channel function due to their colocalization in close proximity to the Golgi apparatus. PMID: 27009467
  2. Human TMEM176A and 176B protein levels are significantly elevated in lymphoma, but not in normal tissues PMID: 22244448
Database Links

HGNC: 29596

OMIM: 610385

KEGG: hsa:28959

STRING: 9606.ENSP00000318409

UniGene: Hs.647090

Protein Families
TMEM176 family
Subcellular Location
Nucleus membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in lung and dermal fibroblasts.

Q&A

What is the basic structure and cellular localization of TMEM176B?

TMEM176B (also known as LR8 or MS4B2) is a member of the membrane-spanning 4-domains (MS4) family of transmembrane proteins. It functions as a putative ion channel and was initially discovered in 1999 with elevated expression in pulmonary fibroblasts . The protein is primarily localized in the plasma membrane and endosomal compartments where it participates in regulating the acidification of endophagosomes via sodium channels. For experimental characterization, researchers typically use subcellular fractionation followed by Western blotting or immunofluorescence microscopy with organelle-specific markers to confirm localization patterns.

How does TMEM176B expression vary across normal tissues versus pathological states?

TMEM176B shows variable expression across different tissues. In normal tissues, it is prominently expressed in immature dendritic cells (DCs) and shows decreased expression during DC maturation . In pathological states, particularly in cancer, TMEM176B expression is significantly elevated. Immunohistochemical analyses and database evaluations (such as TCGA/GTEx) have confirmed increased TMEM176B expression in lung adenocarcinoma (LUAD) compared to adjacent normal tissues . Researchers investigating expression patterns should consider employing both transcriptomic and proteomic approaches, as expression levels can vary between mRNA and protein.

What methodologies are most effective for detecting and quantifying TMEM176B expression in research samples?

For TMEM176B detection and quantification, researchers should employ a multi-modal approach:

  • Transcriptomic analysis: RT-qPCR for targeted gene expression, or RNA-seq for genome-wide expression profiling

  • Protein detection: Western blotting for semi-quantitative analysis, ELISA for quantitative measurement

  • Tissue localization: Immunohistochemistry (IHC) on tissue microarrays for spatial distribution analysis

  • Single-cell analysis: Single-cell RNA sequencing for heterogeneity assessment

Importantly, validation across multiple techniques is recommended as TMEM176B expression can vary at transcriptional and translational levels, particularly in cancer samples .

What cellular and animal models are most suitable for studying TMEM176B functions?

Based on recent research, the following experimental models have proven effective:

Cellular Models:

  • Lung adenocarcinoma cell lines (PC9, A549) for cancer-related studies

  • Breast cancer cell lines (MDA-MB-231) for investigating proliferation and migration

  • Dendritic cells for immune regulatory function studies

Animal Models:

  • CDX (cell-derived xenograft) models using PC9 and A549 cells overexpressing TMEM176B for in vivo tumor growth assessment

  • Syngeneic tumor models for studying TMEM176B in the context of an intact immune system

  • TMEM176B knockout mice for investigating physiological functions in immunological tolerance

When selecting models, researchers should consider the specific cellular context relevant to their research question, as TMEM176B functions can vary significantly across different tissues and disease states.

What are the optimal methods for TMEM176B gene manipulation in experimental models?

For effective TMEM176B manipulation, researchers have employed several complementary approaches:

  • Overexpression systems: Plasmid-based overexpression (as used in PC9 TMEM176Boe and A549 TMEM176Boe models) is effective for gain-of-function studies

  • Gene silencing: shRNA or siRNA for transient knockdown; CRISPR-Cas9 for permanent knockout

  • Pharmacological inhibition: TMEM176B-targeting antibodies have demonstrated efficacy in inhibiting cellular functions similar to gene silencing

  • Inducible expression systems: Tet-On/Off systems for temporal control of TMEM176B expression

Validation of manipulation efficiency should include both mRNA and protein level assessments, as post-transcriptional regulation may influence final protein expression.

What functional assays are most informative for characterizing TMEM176B phenotypes?

Based on published research, the following functional assays provide valuable insights into TMEM176B biology:

In vitro assays:

  • Cell proliferation assays (measured over multiple days, e.g., day 3 assessment)

  • Invasion assays using transwell chambers with Matrigel coating

  • Migration assays (wound healing or transwell)

  • Cell-matrix adhesion assays

  • Tube formation assays with HUVECs treated with conditioned medium from TMEM176B-manipulated cells

In vivo assays:

  • Tumor growth measurements in xenograft models

  • Analysis of metastatic potential

  • Survival analysis in animal models

These assays should be complemented with molecular analyses of downstream pathways (e.g., FGFR/JNK/Vimentin/Snail or AKT/mTOR signaling) to connect functional phenotypes with underlying mechanisms .

How does TMEM176B expression correlate with cancer progression and patient outcomes?

TMEM176B expression shows significant correlation with cancer progression and patient outcomes across multiple cancer types:

Researchers should consider multivariate analyses when studying these correlations to account for confounding factors and should validate findings across independent patient cohorts.

What molecular mechanisms underlie TMEM176B's role in epithelial-mesenchymal transition (EMT)?

TMEM176B regulates EMT through a complex signaling cascade that involves:

  • FGFR1/JNK/Vimentin/Snail signaling axis: TMEM176B overexpression increases JNK and p-JNK protein levels, subsequently elevating Vimentin and Snail expression .

  • E-cadherin downregulation: IHC staining results demonstrate that TMEM176B overexpression leads to decreased E-cadherin expression, a hallmark of EMT .

  • ECM interactions: Cell-cell communication analysis using CellChat indicates that TMEM176B overexpression enhances interactions between cancer cells and endothelial cells, particularly involving JAM, SPP1, gelatin, and ECM components like fibronectin and collagen .

  • CXCL8 subgroup interactions: Enhanced interactions involve SPP1 and ECM components such as laminins and integrins, which are crucial regulators of EMT .

To investigate these mechanisms, researchers should employ:

  • Phospho-protein analysis for signaling pathway activation

  • Co-immunoprecipitation (Co-IP) to detect protein-protein interactions

  • Transcription factor binding assays for Snail target genes

  • Cell-cell communication analysis tools (e.g., CellChat)

How does TMEM176B influence tumor microenvironment and angiogenesis?

TMEM176B has significant effects on the tumor microenvironment and angiogenesis:

  • Endothelial cell activation: Conditioned medium from TMEM176B-overexpressing cells enhances tube formation in HUVEC cells, indicating pro-angiogenic activity. The total tube perimeter increases significantly (7980.78 ± 1711.93 μm for PC9 TMEM176Boe cells compared to control cells at 6177.40 ± 1260.27 μm) .

  • Intercellular crosstalk: Cell-cell communication analysis reveals enhanced interaction strength between cancer cells and endothelial cells when TMEM176B is overexpressed .

  • ECM remodeling: TMEM176B promotes the expression of matrix proteins involved in tumor invasion and metastasis.

  • Immune modulation: Originally identified as a regulator of dendritic cell maturation, TMEM176B may create an immunosuppressive microenvironment favorable for tumor growth .

Researchers investigating these aspects should employ co-culture systems, conditioned media experiments, and multi-parameter flow cytometry to assess the complex intercellular interactions in the tumor microenvironment.

How does TMEM176B interact with the FGFR/JNK signaling cascade in cancer cells?

TMEM176B regulates the FGFR/JNK signaling cascade through a mechanism that can be experimentally elucidated through:

  • Pathway activation analysis: Western blotting demonstrates that TMEM176B overexpression significantly increases JNK and p-JNK protein levels, particularly in PC9 cells compared to A549 cells .

  • Inhibitor studies: Treatment with FGFR inhibitors reduces JNK and p-JNK levels in TMEM176B-overexpressing cells to levels comparable with control cells .

  • Downstream effector regulation: TMEM176B influences downstream molecules such as Vimentin and Snail, which follow similar expression patterns as JNK activation .

  • Specificity of pathway interaction: Notably, ERK1/2, p-ERK1/2, and Slug show no significant changes, suggesting specificity in TMEM176B's interaction with the FGFR/JNK pathway rather than broader MAPK pathway activation .

For researchers investigating this pathway, combining pharmacological inhibitors with genetic manipulation approaches provides the most comprehensive understanding of TMEM176B's role in FGFR/JNK signaling.

What is the relationship between TMEM176B and the AKT/mTOR pathway?

TMEM176B regulates the AKT/mTOR signaling pathway, particularly in breast cancer models:

  • Studies suggest that the AKT/mTOR signaling pathway is a major pathway in TMEM176B-dependent signaling in triple-negative breast cancer .

  • Interestingly, in lung adenocarcinoma models, administration of AKT or PI3K inhibitors did not yield a significant impact on cell proliferation, suggesting context-dependent signaling mechanisms .

  • This contrast highlights the tissue-specific nature of TMEM176B signaling, where it may preferentially activate different downstream pathways depending on the cellular context.

Researchers investigating these pathways should conduct parallel studies across multiple cell types, using both genetic and pharmacological approaches to inhibit pathway components, and monitor multiple downstream effectors to capture the full complexity of TMEM176B-mediated signaling.

How do post-translational modifications affect TMEM176B function and signaling?

While the search results don't directly address post-translational modifications (PTMs) of TMEM176B, this represents an important area for future research. Based on the membrane protein nature and signaling functions of TMEM176B, researchers should consider investigating:

  • Phosphorylation sites: Potential regulatory sites that may affect channel activity or protein-protein interactions

  • Glycosylation patterns: Common PTMs for transmembrane proteins that may affect trafficking and surface expression

  • Ubiquitination: May regulate protein turnover and stability

  • Palmitoylation: Could affect membrane microdomain localization

Methodological approaches should include:

  • Mass spectrometry-based proteomics for comprehensive PTM mapping

  • Site-directed mutagenesis of potential modification sites

  • Pharmacological inhibitors of specific PTM pathways

  • Co-immunoprecipitation under different cellular conditions to identify context-dependent interaction partners

What approaches are most promising for targeting TMEM176B in cancer therapy?

Based on current research, several approaches show promise for targeting TMEM176B therapeutically:

  • Neutralizing antibodies: Studies have demonstrated that treating cancer cells with TMEM176B antibodies reduces cell proliferation, suggesting the potential of this gene as a target for therapy .

  • Small molecule inhibitors: Targeting the ion channel function of TMEM176B may disrupt its cellular activities.

  • Signaling pathway inhibitors: Targeting downstream pathways such as FGFR/JNK or AKT/mTOR may be effective in TMEM176B-overexpressing tumors .

  • Gene silencing approaches: Though currently limited to experimental models, siRNA or CRISPR-based approaches could potentially be developed for therapeutic applications.

For researchers working on therapeutic development, combination approaches that target both TMEM176B and its downstream effectors may provide synergistic benefits and reduce the likelihood of resistance development.

How does TMEM176B expression and function relate to responsiveness to existing cancer therapies?

The relationship between TMEM176B and therapeutic responsiveness represents an important area for investigation:

  • Given the role of TMEM176B in promoting aggressive cancer phenotypes and poorer prognosis, its expression may correlate with resistance to conventional therapies.

  • The involvement of TMEM176B in EMT suggests that it might contribute to chemotherapy resistance, as EMT is often associated with reduced sensitivity to cytotoxic agents.

  • TMEM176B's role in tumor microenvironment remodeling may influence response to anti-angiogenic therapies and immunotherapies.

Researchers exploring these relationships should:

  • Perform retrospective analyses correlating TMEM176B expression with treatment outcomes

  • Combine TMEM176B inhibition with standard therapies in preclinical models

  • Investigate changes in TMEM176B expression following treatment as a potential resistance mechanism

What biomarker strategies can be developed for TMEM176B in clinical applications?

TMEM176B shows potential as a biomarker in several contexts:

  • Prognostic biomarker: Higher TMEM176B expression is associated with poorer outcomes in lung adenocarcinoma and other cancers, suggesting utility as a prognostic marker .

  • Patient stratification: TMEM176B expression patterns could help identify patients who might benefit from specific targeted therapies.

  • Monitoring treatment response: Changes in TMEM176B expression or downstream signaling activity could serve as pharmacodynamic markers.

  • Early detection: If elevated in early-stage disease, TMEM176B could potentially contribute to early detection strategies.

Researchers developing biomarker applications should:

  • Validate findings across multiple independent cohorts

  • Establish standardized detection methods suitable for clinical implementation

  • Evaluate TMEM176B in combination with other biomarkers for improved specificity and sensitivity

  • Consider both tissue and liquid biopsy approaches for detection

How does TMEM176B interact with the tumor immune microenvironment?

TMEM176B was initially characterized for its role in immune regulation, particularly dendritic cell (DC) maturation and antigen presentation. In the cancer context, this raises important questions:

  • How does cancer cell-expressed TMEM176B influence tumor-infiltrating immune cells?

  • Does TMEM176B contribute to immune evasion mechanisms?

  • Could TMEM176B inhibition enhance immunotherapy response?

Research approaches should include:

  • Single-cell RNA sequencing of tumor microenvironments with varying TMEM176B expression

  • Spatial transcriptomics to map TMEM176B expression relative to immune cell infiltration

  • Combined inhibition of TMEM176B with immune checkpoint inhibitors in preclinical models

  • Analysis of NLRP3 inflammasome activation in relation to TMEM176B expression

What is the role of TMEM176B in cancer metastasis beyond primary tumor growth?

The search results indicate TMEM176B's involvement in promoting cell migration, invasion, and EMT, all processes associated with metastasis. Future research should address:

  • The specific role of TMEM176B in establishing pre-metastatic niches

  • How TMEM176B affects organ-specific metastatic tropism

  • Whether TMEM176B expression in circulating tumor cells correlates with metastatic potential

Methodological approaches should include:

  • Experimental metastasis models (tail vein or intracardiac injection)

  • Spontaneous metastasis models with primary tumor resection

  • Analysis of matched primary and metastatic tumor samples for TMEM176B expression

  • Circulating tumor cell isolation and characterization

How do genetic and epigenetic mechanisms regulate TMEM176B expression in different cancer contexts?

Understanding the regulation of TMEM176B expression represents an important knowledge gap:

  • What transcription factors drive TMEM176B upregulation in cancer?

  • Are there epigenetic modifications (DNA methylation, histone modifications) that regulate TMEM176B expression?

  • Do genetic alterations (amplifications, mutations) affect TMEM176B function in cancer?

Research approaches should include:

  • Promoter analysis and transcription factor binding studies

  • Genome-wide association studies correlating genetic variants with TMEM176B expression

  • DNA methylation and histone modification profiling

  • Analysis of cancer genomic databases for TMEM176B alterations across cancer types

By addressing these advanced questions, researchers can develop a more comprehensive understanding of TMEM176B biology and its potential as a therapeutic target in cancer.

What is the role of TMEM176B in normal immune system development and function?

TMEM176B plays significant roles in immune regulation:

  • Initially discovered as a regulator of immunological tolerance

  • Highly expressed in immature dendritic cells (DCs) compared to mature DCs

  • Regulates the acidification of endophagosomes via sodium channels

  • TMEM176B knockout or pharmacologic inhibition demonstrates that it suppresses tumor growth through CD8+ T cells by triggering the activation of inflammasomes

Researchers investigating these functions should consider:

  • Flow cytometry and single-cell analysis of immune cell subsets in TMEM176B knockout models

  • Functional assays of antigen presentation and T cell activation

  • In vivo models of immune tolerance and autoimmunity

  • Analysis of sodium channel activity in relation to endophagosome pH regulation

How does TMEM176B contribute to inflammatory and fibrotic pathologies?

TMEM176B was initially associated with pulmonary fibrosis and showed elevated expression in pulmonary fibroblasts . This suggests broader roles in inflammatory and fibrotic conditions:

  • Potential involvement in tissue remodeling and repair

  • Role in chronic inflammatory conditions

  • Contribution to fibrotic diseases beyond the lungs

Research approaches should include:

  • Analysis of TMEM176B expression in tissue samples from patients with various fibrotic disorders

  • Animal models of inflammation and fibrosis with TMEM176B manipulation

  • In vitro models of fibroblast activation and extracellular matrix production

  • Investigation of TMEM176B's relationship with known pro-fibrotic signaling pathways

What are the structural determinants of TMEM176B ion channel function?

As a putative ion channel, understanding TMEM176B's structure-function relationships is crucial:

  • What are the key domains responsible for ion selectivity and gating?

  • How does TMEM176B assembly into functional channels occur?

  • What are the pharmacological modulators of TMEM176B channel activity?

Research approaches should include:

  • Structural biology techniques (X-ray crystallography, cryo-EM)

  • Site-directed mutagenesis of putative channel domains

  • Electrophysiological recordings of channel activity

  • Molecular dynamics simulations to predict channel behavior

  • Development of selective channel modulators as research tools

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.