Recombinant Human Transmembrane protein 177 (TMEM177)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder

Note: We will prioritize shipping the format currently in stock. If you require a specific format, please specify this in your order notes, and we will accommodate your request to the best of our ability.

Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.

Note: All proteins are shipped with standard blue ice packs unless otherwise requested. Dry ice shipping requires prior arrangement and incurs additional charges.

Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, briefly centrifuge the vial to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, and this can be used as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.

Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.

Synonyms
TMEM177; Transmembrane protein 177
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-311
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
TMEM177
Target Protein Sequence
MAGPLWRTAAFVQRHRTGLLVGSCAGLFGVPISYHLFPDPVVQWLYQYWPQGQPAPLPPQ LQSLFQEVLQDIGVPSGHCYKPFTTFTFQPVSAGFPRLPAGAVVGIPASFLGDLVINTNH PVVIHGHTVDWRSPAGARLRASLTLSREAQKFALAREVVYLESSTTAVHALLAPACLAGT WALGVGAKYTLGLHAGPMNLRAAFSLVAAVAGFVAYAFSQDSLTHAVESWLDRRTASLSA AYACGGVEFYEKLLSGNLALRSLLGKDGEKLYTPSGNIVPRHLFRIKHLPYTTRRDSVLQ MWRGMLNPGRS
Uniprot No.

Target Background

Function

TMEM177 plays a crucial role in the early stages of cytochrome c oxidase subunit II (MT-CO2/COX2) maturation. It is essential for the stabilization of COX20 and the newly synthesized MT-CO2/COX2 protein.

Gene References Into Functions
  1. Studies indicate that TMEM177 imbalance results in the accumulation of newly synthesized COX2 in a COX20-associated state. PMID: 29154948
Database Links

HGNC: 28143

KEGG: hsa:80775

STRING: 9606.ENSP00000272521

UniGene: Hs.439991

Protein Families
TMEM177 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Human Transmembrane Protein 177 (TMEM177)?

TMEM177 is a mitochondrial protein located in the inner mitochondrial membrane that has been identified as a component of the COX20 interaction network. It plays a critical role in the assembly of cytochrome c oxidase (COX), specifically in the biogenesis of the COX2 subunit. Experimental evidence demonstrates that TMEM177 affects the stability and turnover of the COX2 protein, which is essential for proper functioning of the mitochondrial respiratory chain. The protein lacks a clear homolog in yeast, suggesting it may represent a specialized adaptation in higher eukaryotes for COX assembly .

What is the subcellular localization of TMEM177?

TMEM177 is primarily localized to the inner mitochondrial membrane as determined through subcellular fractionation experiments. This localization can be verified using multiple complementary approaches: (1) Mitochondrial isolation via differential centrifugation followed by Western blotting; (2) Carbonate extraction experiments, in which TMEM177 remains in the insoluble membrane fraction at pH 10.8-11.5, confirming its status as an integral membrane protein; (3) Protease protection assays using mitoplasts, which can reveal the topology of TMEM177 within the membrane; and (4) Immunofluorescence microscopy using cells expressing tagged TMEM177 (e.g., TMEM177FLAG) co-stained with MitoTracker to confirm mitochondrial localization .

What is the functional role of TMEM177 in mitochondria?

TMEM177 promotes the assembly of the COX2 subunit of cytochrome c oxidase at the level of CuA-site formation. It associates with newly synthesized COX2 and the copper chaperone SCO2 in a COX20-dependent manner. The protein appears to function at a critical juncture in COX assembly, where it facilitates the progression of COX2 through its biogenesis pathway. Experimental evidence indicates that manipulation of TMEM177 levels (either through depletion or overexpression) leads to accumulation of newly synthesized COX2 in a COX20-associated state, suggesting that TMEM177 helps COX2 transition from its initial scaffold (COX20) to subsequent assembly stages involving copper incorporation and ultimate integration into the mature COX complex .

How can researchers effectively knockdown or knockout TMEM177 for functional studies?

For TMEM177 knockdown or knockout studies, researchers can employ several complementary approaches:

  • siRNA-mediated knockdown:

    • Specific siRNA sequence: 5′-GACACUUGUUCCGAAUCAA-3′ (50 nM final concentration)

    • Transfection reagent: Lipofectamine RNAiMAX according to manufacturer's specifications

    • Cell density: 500,000 cells/25 cm²

    • Analysis timepoint: 72 hours post-transfection

    • Validation method: Western blot analysis

  • CRISPR/Cas9-mediated knockout:

    • Design guide RNAs targeting exonic regions of TMEM177

    • Co-transfect with selection marker (e.g., pEGFP-N1)

    • Isolate single clones via FACS sorting

    • Validate edited clones by sequencing and Western blotting

    • Confirm complete protein loss with specific antibodies

  • Phenotypic analysis following manipulation:

    • Assess COX20 protein levels, which should decrease upon TMEM177 depletion

    • Evaluate COX assembly via Blue Native PAGE

    • Measure cytochrome c oxidase activity through spectrophotometric assays

    • Analyze mitochondrial translation products with [35S]methionine labeling

    • Monitor stability of newly synthesized COX2

What techniques are used to study TMEM177's interactions with the COX assembly machinery?

Several complementary methods can be employed to elucidate TMEM177's interactions:

  • Co-immunoprecipitation (Co-IP):

    • Solubilize mitochondria with mild detergents (e.g., 1% digitonin)

    • Immunoprecipitate TMEM177 using specific antibodies or epitope tags

    • Analyze co-precipitating proteins by Western blotting or mass spectrometry

    • Include appropriate controls (IgG, non-expressing cells)

  • Quantitative interaction proteomics:

    • SILAC labeling of cells (light vs. heavy amino acids)

    • Affinity purification of tagged TMEM177

    • Mass spectrometric analysis with ≥1 unique peptide and false discovery rate of 0.01

    • Statistical analysis: plot log10-transformed protein ratios against p-values

    • Data revealed TMEM177 as significantly enriched in COX20FLAG pulldowns

  • In vivo labeling of mitochondrial translation products:

    • Inhibit cytosolic translation with anisomycin (100 μg/mL) or emetine

    • Pulse label with [35S]methionine (0.2 mCi/mL) for defined periods

    • Perform immunoprecipitation to identify nascent chain associations

    • Analyze by SDS-PAGE and phosphorimaging

    • Quantify using appropriate software (e.g., ImageQuant TL)

How should researchers design experiments to assess the impact of TMEM177 on COX2 biogenesis?

A comprehensive experimental approach should include:

  • Analysis of COX2 synthesis and stability:

    • Pulse-chase labeling: Label mitochondrial translation products with [35S]methionine for 2h, followed by chase periods (3h, 12h)

    • Compare COX2 stability in wild-type vs. TMEM177-manipulated cells

    • Quantify COX2 signal over time normalized to other mitochondrial translation products

  • Assessment of assembly intermediates:

    • BN-PAGE analysis of digitonin-solubilized mitochondria

    • Western blotting to detect COX2-containing complexes

    • Second-dimension SDS-PAGE to resolve components of each complex

    • Evaluation of COX2 distribution among assembly stages

  • Analysis of copper insertion:

    • Monitor association of COX2 with copper chaperones (SCO1, SCO2)

    • Assess CuA site formation through spectroscopic methods

    • Compare copper binding in presence/absence of TMEM177

  • Experimental design matrix:

    ConditionTranslation AnalysisStability AssessmentComplex AssemblyCopper Insertion
    ControlPulse labelingChase periods (3h, 12h)BN-PAGESCO1/2 association
    TMEM177 KDPulse labelingChase periods (3h, 12h)BN-PAGESCO1/2 association
    TMEM177 OEPulse labelingChase periods (3h, 12h)BN-PAGESCO1/2 association

This design allows for comprehensive assessment of how TMEM177 impacts each stage of COX2 biogenesis from synthesis to assembly .

How does TMEM177 interact with the COX assembly pathway?

TMEM177 interacts with the COX assembly pathway primarily through its association with COX20, a scaffold protein that recruits metallochaperones for copper delivery to the CuA-Site of COX2. Current experimental evidence supports the following model:

  • Newly synthesized COX2 engages with COX20 in the inner mitochondrial membrane immediately after translation

  • TMEM177 associates with this COX2-COX20 complex in a specific manner

  • This interaction facilitates the recruitment of copper chaperones (SCO1, SCO2) to the complex

  • TMEM177 promotes the formation of the CuA-site in COX2 through an as-yet undetermined mechanism

  • This enables the proper assembly of COX2 into the cytochrome c oxidase complex

Quantitative mass spectrometry has revealed that COX20FLAG significantly enriches TMEM177, alongside COX2 and metallochaperones. Importantly, when TMEM177 levels are altered (either decreased or increased), newly synthesized COX2 accumulates in a COX20-associated state, suggesting that TMEM177 plays a key role in facilitating the progression of COX2 through this assembly pathway rather than in the initial COX2-COX20 interaction .

What is the relationship between TMEM177 levels and COX20 abundance?

Research has demonstrated a direct relationship between TMEM177 levels and COX20 abundance that operates bidirectionally:

  • Loss of TMEM177 effects:

    • siRNA-mediated knockdown leads to significant reduction in COX20 protein levels

    • This effect is specific, as other assembly factors (C12ORF62/COX14, MITRAC12/COA3) remain unaffected

    • The mechanism appears to be post-transcriptional, suggesting protein stabilization

  • TMEM177 overexpression effects:

    • Increased TMEM177 leads to elevated COX20 protein levels

    • This confirms the direct correlation between these two proteins

  • Mechanistic implications:

    TMEM177 StatusCOX20 LevelCOX2 StabilityEffect on Assembly
    KnockdownDecreasedIncreasedAccumulated intermediate
    NormalNormalNormalNormal progression
    OverexpressionIncreasedIncreasedAccumulated intermediate

This relationship suggests that TMEM177 may protect COX20 from degradation or facilitate its incorporation into stable complexes. The fact that both decreased and increased levels of TMEM177 lead to accumulation of COX2 in assembly intermediates points to an optimal stoichiometry between TMEM177 and COX20 being critical for efficient COX2 biogenesis .

What techniques are optimal for studying TMEM177's role in mitochondrial translation?

To investigate TMEM177's impact on mitochondrial translation, researchers should employ:

  • Pulse labeling of mitochondrial translation products:

    • Inhibit cytosolic translation using emetine (100 μg/mL) or anisomycin (100 μg/mL)

    • Label mitochondrial translation products with [35S]methionine (0.2 mCi/mL) for 1-2 hours

    • Analyze labeled products via SDS-PAGE followed by detection using Storage Phosphor Screens

    • Quantify signals with ImageQuant TL software

    • Compare the synthesis pattern of 13 mitochondrially-encoded proteins

  • Pulse-chase analysis:

    • After pulse labeling (2h), replace radioactive media with standard growth media

    • Continue incubation for defined chase periods (3h, 12h)

    • Monitor stability of newly synthesized proteins, particularly COX2

    • Calculate half-lives of mitochondrial translation products in control vs. TMEM177-manipulated cells

  • Analysis of translation in different genetic backgrounds:

    BackgroundLabeling MethodKey Parameters to Assess
    Control1h pulseAll 13 mitochondrial proteins
    TMEM177 KD1h pulseFocus on COX1, COX2, COX3
    COX20 KD1h pulseCompare with TMEM177 KD pattern
    Double KD1h pulseEpistatic relationship
  • Co-immunoprecipitation of nascent chains:

    • Perform brief pulse labeling (10-20 min)

    • Immunoprecipitate TMEM177 or COX20

    • Analyze co-precipitating newly synthesized proteins

    • Determine timing of TMEM177 association with nascent COX2

These approaches collectively provide comprehensive insights into how TMEM177 affects the synthesis, stability, and early interactions of mitochondrially-encoded proteins.

How can researchers determine TMEM177's submitochondrial localization?

Precise determination of TMEM177's submitochondrial localization requires multiple complementary approaches:

  • Subcellular fractionation:

    • Harvest cells and homogenize in hypotonic buffer

    • Perform differential centrifugation: 800×g to remove nuclei/debris, 11,000×g to isolate mitochondria

    • Verify mitochondrial fraction purity using marker proteins

    • Resuspend mitochondria in TH buffer containing 250 mM sucrose, 10 mM MOPS pH 7.2

  • Membrane extraction experiments:

    • Resuspend isolated mitochondria in buffers containing:
      a) 1% Triton X-100 (positive control for solubilization)
      b) 0.1M carbonate at pH 10.5 (extracts peripheral membrane proteins)
      c) 0.1M carbonate at pH 11.8 (more stringent extraction)

    • Ultracentrifuge at 55,000 rpm for 45 min (TLA-55 rotor)

    • Analyze supernatant (soluble) and pellet (membrane) fractions by Western blotting

    • Compare TMEM177 behavior to known integral (COX2) and peripheral membrane proteins

  • Protease protection assays:

    • Prepare samples of:
      a) Intact mitochondria (SEM buffer: 250 mM sucrose, 1 mM EDTA, 10 mM MOPS pH 7.2)
      b) Mitoplasts (EM buffer: 1 mM EDTA, 10 mM MOPS pH 7.2)
      c) Triton X-100 lysed mitochondria (1% detergent)

    • Treat with Proteinase K

    • Stop reaction with PMSF (2 mM)

    • Analyze protection pattern by Western blotting

    • Interpret topology based on fragment patterns

  • Immunofluorescence microscopy:

    • Express tagged TMEM177 (TMEM177FLAG) in HeLa cells for 12h

    • Incubate with MitoTracker red for 5 min

    • Fix with 4% paraformaldehyde (20 min, 37°C)

    • Permeabilize with 0.2% Triton X-100 (20 min, RT)

    • Block with appropriate blocking solution

    • Perform immunostaining and confocal microscopy

These methods consistently demonstrate that TMEM177 is an integral protein of the inner mitochondrial membrane with specific topology.

What are the best methods for studying TMEM177 protein-protein interactions?

To comprehensively characterize TMEM177 protein-protein interactions, researchers should implement:

  • SILAC-based quantitative interaction proteomics:

    • Culture cells in light or heavy amino acid-containing media

    • Generate stable cell lines expressing tagged proteins (e.g., COX20FLAG)

    • Perform affinity purification under native conditions (digitonin solubilization)

    • Analyze by mass spectrometry with stringent parameters:

      • ≥1 unique peptide identification

      • False discovery rate of 0.01 for peptides and proteins

      • SILAC quantification based on unique peptides and ≥1 ratio count

    • Plot mean log10 protein ratios against p-values from Student's t-test

    • This approach successfully identified TMEM177 as a COX20 interactor

  • Co-immunoprecipitation validation:

    • Solubilize mitochondria with digitonin (1%)

    • Immunoprecipitate target protein with specific antibodies

    • Western blot for interacting partners

    • Include appropriate controls:

      • IgG control

      • Knockout/knockdown validation

      • Reciprocal co-IPs

  • Interaction mapping through mutagenesis:

    • Generate truncation or point mutants of TMEM177

    • Perform co-IP experiments to map interaction domains

    • Correlate interaction defects with functional outcomes

    • Establish structure-function relationships

  • In organello crosslinking:

    • Treat isolated mitochondria with crosslinkers (e.g., DSP, formaldehyde)

    • Immunoprecipitate under denaturing conditions

    • Identify crosslinked adducts by mass spectrometry

    • Map specific interaction sites at amino acid resolution

These approaches together provide robust characterization of the TMEM177 interactome, establishing its position within the COX assembly pathway .

How should contradictory findings about TMEM177 function be reconciled?

When facing contradictory findings about TMEM177 function, researchers should employ a systematic approach:

  • Methodological reconciliation:

    • Compare experimental techniques used in different studies

    • Assess differences in:

      • Cell types and growth conditions

      • Knockdown/knockout strategies and efficiency

      • Assay sensitivities and detection methods

    • Replicate key experiments using standardized protocols

  • Context-dependent function analysis:

    • Examine cell type-specific effects

    • Investigate potential compensatory mechanisms

    • Consider the following possible scenarios:

    ObservationPotential ExplanationValidation Approach
    TMEM177 KD shows minimal COX defectFunctional redundancyDouble KD with related proteins
    TMEM177 overexpression impairs COX assemblyStoichiometric imbalanceTitration experiments
    Discrepant protein interaction dataDifferent solubilization conditionsStandardized IP protocol
  • Integrated multi-omics approach:

    • Combine data from genomics, proteomics, and functional assays

    • Use statistical methods to identify consistent patterns across datasets

    • Develop mechanistic models that account for apparent contradictions

    • Test predictions from these models experimentally

  • Time-resolved analysis:

    • Consider temporal aspects of TMEM177 function

    • Acute vs. chronic loss-of-function may yield different phenotypes

    • Examine adaptation processes over time

What statistical approaches should be used to analyze TMEM177 interaction data?

For robust analysis of TMEM177 interaction data, researchers should implement:

  • SILAC-based interaction statistics:

    • Calculate protein ratios between experimental and control conditions

    • Log10-transform ratios to normalize distribution

    • Determine mean log10 ratios across replicates (n ≥ 2)

    • Apply Student's t-test to calculate p-values

    • Plot results as volcano plots (ratio vs. p-value)

    • Define significance thresholds based on both enrichment and p-value

  • Filtering criteria for mass spectrometry data:

    • Require ≥1 unique peptide for protein identification

    • Set false discovery rate to 0.01 for peptides and proteins

    • Base quantification on unique peptides

    • Require ≥1 ratio count for quantification

    • Apply these criteria consistently across experiments

  • Network analysis methods:

    • Generate interaction networks from proteomics data

    • Calculate interaction confidence scores

    • Identify network clusters and functional modules

    • Integrate with known protein complexes from databases

    • Visualize networks to highlight key interactions

  • Validation through multiple approaches:

    • Statistical power calculation to determine sample size

    • Multiple biological and technical replicates

    • Orthogonal validation of key interactions

    • Quantitative analysis of interaction strength

    • Control for common contaminants and false positives

These statistical approaches enhance the reliability of interaction data and provide confidence in identifying genuine TMEM177 interaction partners .

What are the promising avenues for structural investigation of TMEM177?

Future structural investigations of TMEM177 should focus on:

These approaches would significantly advance understanding of how TMEM177 structurally contributes to COX assembly and copper insertion into COX2 .

How might TMEM177 research impact our understanding of mitochondrial disease mechanisms?

TMEM177 research has significant potential to enhance our understanding of mitochondrial disease mechanisms:

  • Novel candidate gene identification:

    • TMEM177 mutations could be investigated in patients with:

      • Unexplained COX deficiency

      • Leigh syndrome-like presentations

      • Mitochondrial encephalomyopathy

    • Whole-exome sequencing data from existing patient cohorts could be re-examined specifically for TMEM177 variants

  • Mechanisms of copper metabolism disorders:

    • TMEM177's involvement in COX2 copper insertion links it to copper metabolism

    • Could provide insights into conditions like:

      • SCO1/SCO2-related disorders

      • Menkes disease-like presentations

      • Copper deficiency syndromes with mitochondrial manifestations

  • Therapeutic development opportunities:

    • Understanding the TMEM177-COX20-COX2 axis could lead to:

      • Small molecule stabilizers of protein interactions

      • Gene therapy approaches targeting this pathway

      • Metabolic bypass strategies for copper delivery

  • Biomarker potential:

    • TMEM177 levels or post-translational modifications could serve as:

      • Diagnostic markers for specific mitochondrial disorders

      • Prognostic indicators for disease progression

      • Pharmacodynamic markers for therapeutic interventions

Research on TMEM177 thus provides a window into the intricate mechanisms of COX assembly and how disruption of this process contributes to human disease, potentially leading to novel diagnostic and therapeutic approaches .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.