Recombinant Human Transmembrane protein 178 (TMEM178)

Shipped with Ice Packs
In Stock

Description

General Information

TMEM178 is a transmembrane protein that, in humans, is encoded by the TMEM178B gene . The mouse ortholog of TMEM178 is involved in the negative regulation of osteoclast differentiation and the regulation of cytosolic calcium ion concentration, and is located in the endoplasmic reticulum membrane .

Function and Mechanism

TMEM178 functions in a negative feedback loop that targets NFATc1 . Specifically, TMEM178 acts as a PLCγ2-dependent protein that controls $$Ca^{2+} $$ fluxes in osteoclasts (OCs) . TMEM178 resides in the endoplasmic reticulum (ER) and binds to Stim1, an ER $$Ca^{2+} $$ sensor that controls $$Ca^{2+} $$ fluxes during osteoclastogenesis .

Role in Bone Metabolism

Research indicates that TMEM178 suppresses OC differentiation via a negative feedback loop downstream of PLCγ2 . In experiments with Tmem178-null mice, a decrease in trabecular bone volume and significant trabecular thinning was observed . Moreover, these mice displayed an increase in OC surface normalized to bone surface, suggesting that TMEM178 normally functions to restrain osteoclastogenesis .

Involvement in Inflammatory Osteolysis

Studies show that TMEM178 modulates OC formation driven by inflammatory cytokines . The addition of TNF-α or LPS exacerbates Tmem178-null OC differentiation in vitro . Tmem178-null mice injected with LPS develop profound focal osteolysis and increased OC surface, indicating that TMEM178 restrains inflammatory bone loss .

Clinical Significance

Reduced TMEM178 expression in human cells correlates with excessive osteoclastogenesis, similar to observations in mouse models . Furthermore, Stim1 SNPs have been identified in patients with ankylosing spondylitis (AS), and reduced TMEM178 expression is associated with augmented osteoclastogenesis in the context of systemic juvenile idiopathic arthritis (sJIA) . TMEM178 could potentially serve as a marker to identify sJIA patients who will develop erosive disease .

TMEM88 as a related target in Malignant Tumors

TMEM88, or transmembrane protein 88, is a double-transmembrane protein that regulates downstream effectors by mediating different signaling pathways and is involved in cell proliferation, differentiation, apoptosis, and tumor progression . Abnormal changes in TMEM88 have been observed in breast, ovarian, lung, and thyroid cancers .

TMEM88 is encoded by a gene consisting of 1214 bases located at the p13.1 position on chromosome 17, and the corresponding protein is a 159 amino acid residue with a molecular weight of 17251 Da . TMEM88 can inhibit Wnt/β-catenin signal activation in human embryonic stem cells, regulating their differentiation and development into cardiomyocytes . The functions of TMEM88 vary depending on tissue and subcellular locations .

FeatureDescription
Gene Locationp13.1 position on chromosome 17
Amino Acid Residue Count159
Molecular Weight17251 Da
ExpressionPresent in a variety of tumors with differing functions depending on tissue and subcellular locations
Cytoplasmic LocalizationCorrelated with TNM stage and lymph node metastasis in triple-negative breast cancer
Nuclear LocalizationNegatively correlated with lymph node metastasis in non-triple-negative breast cancer
Ovarian CancerDownregulates c-Myc and Cyclin D1 levels, inhibiting cell proliferation
Non-Small-Cell Lung CancerHigh expression is positively correlated with better patient prognosis; overexpression inhibits proliferation, invasion, and migration of LK2 cells, preventing transplanted tumor growth in nude mice; methylation degree is higher in NSCLC tissues than in normal tissues; overexpression reduces transcriptional activity of TCF/LEF and inhibits expression of downstream target genes c-Myc and cyclin D1 of the Wnt/β-catenin signaling pathway
Bladder CancerOverexpression inhibits activation of the Wnt/β-catenin signaling pathway by reducing the phosphorylation level of GSK-3β (Ser9 site)
Triple-Negative Breast CancerOverexpression or silencing does not affect activity of the canonical Wnt signaling pathway or the expression of corresponding target genes

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. Please specify your required tag type for preferential development.
Synonyms
TMEM178A; TMEM178; PSEC0131; UNQ5926/PRO19820; Transmembrane protein 178A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
26-297
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
TMEM178A
Target Protein Sequence
IFTDHWYETDPRRHKESCERSRAGADPPDQKNRLMPLSHLPLRDSPPLGRRLLPGGPGRA DPESWRSLLGLGGLDAECGRPLFATYSGLWRKCYFLGIDRDIDTLILKGIAQRCTAIKYH FSQPIRLRNIPFNLTKTIQQDEWHLLHLRRITAGFLGMAVAVLLCGCIVATVSFFWEESL TQHVAGLLFLMTGIFCTISLCTYAASISYDLNRLPKLIYSLPADVEHGYSWSIFCAWCSL GFIVAAGGLCIAYPFISRTKIAQLKSGRDSTV
Uniprot No.

Target Background

Function
Recombinant Human Transmembrane protein 178 (TMEM178) acts as a negative regulator of osteoclast differentiation under basal and inflammatory conditions. This regulation is achieved by modulating TNFSF11-induced Ca2+ fluxes, thereby controlling the induction of NFATC1.
Gene References Into Functions
  1. TMEM178, localized to the ER membrane, regulates RANKL-induced Ca2+ fluxes, thus controlling NFATc1 induction. PMID: 26644563
Database Links

HGNC: 28517

KEGG: hsa:130733

STRING: 9606.ENSP00000281961

UniGene: Hs.40808

Protein Families
TMEM178 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is human TMEM178 and where is it primarily expressed?

TMEM178 is a transmembrane protein that localizes to the endoplasmic reticulum (ER) membrane in various cell types. It was identified as a downstream target gene of Phospholipase C gamma-2 (PLCγ2) signaling. TMEM178 is prominently expressed in myeloid cells, including macrophages and osteoclasts, and plays an important role in regulating calcium signaling pathways . Immunofluorescence studies have confirmed its localization specifically to the ER but not the plasma membrane in mature osteoclasts .

What is the domain structure of TMEM178?

TMEM178 contains transmembrane domains that are critical for its function and protein-protein interactions. Key residues in the transmembrane region, specifically L212 and M216, have been identified as essential for its interaction with the calcium sensor protein STIM1 . These structural elements are important considerations when designing recombinant versions of the protein for experimental purposes or when developing mutants to study structure-function relationships.

How does TMEM178 differ between species?

While the search results don't explicitly detail species differences, research on TMEM178 has been conducted using mouse models (Tmem178-/- mice) to understand its physiological functions. When working with recombinant human TMEM178, researchers should consider potential structural or functional differences compared to murine Tmem178, especially when translating findings from animal models to human applications .

What is the primary function of TMEM178 in calcium signaling?

TMEM178 functions as a negative regulator of store-operated calcium entry (SOCE) in myeloid cells. It modulates calcium fluxes by interacting with STIM1, an ER calcium sensor that controls calcium influx during osteoclastogenesis and other cellular processes. Specifically, TMEM178 limits STIM1 localization to ER-plasma membrane junctions and puncta formation, thereby regulating SOCE activation . In cells lacking TMEM178, intracellular calcium levels show higher amplitude fluxes compared to wild-type cells .

How does TMEM178 interact with STIM1 at the molecular level?

The interaction between TMEM178 and STIM1 occurs via specific amino acid residues. Site-directed mutagenesis, co-immunoprecipitation assays, and FRET imaging have demonstrated that TMEM178 associates with STIM1 through the transmembrane residues L212 and M216 in TMEM178 and G225 in STIM1 . This interaction primarily occurs under resting conditions and decreases in the presence of thapsigargin (which depletes ER calcium stores) and following store-operated calcium entry .

What signaling pathways are regulated by TMEM178?

TMEM178 primarily regulates calcium-dependent signaling pathways, particularly those involving NFATc1 (Nuclear Factor of Activated T-cells, cytoplasmic 1). In osteoclasts, TMEM178 suppresses NFATc1 nuclear translocation and transcriptional activity, thereby limiting the expression of NFATc1 target genes including TRAP (Acp5), Cathepsin K (CtsK), and calcitonin receptor (Calcr) . Importantly, TMEM178 does not appear to significantly affect NF-κB, MAPK, or AKT signaling pathways, as activation of these pathways is equivalent in wild-type and Tmem178-/- bone marrow macrophages .

What are the best methods for expressing and purifying recombinant human TMEM178?

While the search results don't provide specific protocols for TMEM178 purification, researchers should consider standard approaches for membrane protein expression and purification. Based on the nature of TMEM178 as an ER-resident membrane protein, expression systems that properly handle membrane proteins such as insect cells or mammalian cell lines would be appropriate. For purification, detergent-based extraction followed by affinity chromatography using epitope tags (His, FLAG, etc.) could be employed. Special attention should be paid to maintaining protein folding and stability during the purification process.

How can researchers effectively measure TMEM178 function in calcium signaling experiments?

To assess TMEM178 function in calcium signaling, researchers can employ ratiometric calcium imaging using fluorescent indicators such as Fura-2AM, as demonstrated in the referenced studies . This approach allows for measurement of intracellular calcium levels in single cells. Additional methods include:

  • Thapsigargin-induced calcium release experiments in calcium-free medium to assess ER calcium release

  • Store-operated calcium entry assays by adding extracellular calcium following store depletion

  • Measurements of ER calcium content using ionomycin-induced ER calcium emptying

These methods can be applied to cells overexpressing TMEM178 or TMEM178-deficient cells to understand its role in calcium homeostasis .

What experimental models are suitable for studying TMEM178 function?

Several experimental models have proven useful for studying TMEM178 function:

  • Cell lines: HEK293T cells provide a reliable system for overexpression studies and biochemical analyses of TMEM178 interactions. Primary bone marrow macrophages (BMMs) cultured with M-CSF and RANKL are useful for studying TMEM178 in osteoclast differentiation .

  • Mouse models: Tmem178-/- mice have been generated and characterized, showing an osteopenic phenotype with increased osteoclast formation. These mice are also more susceptible to inflammatory bone loss, making them valuable for studying TMEM178's role in both basal and inflammatory conditions .

  • Human samples: Analysis of TMEM178 expression in human CD14+ monocytes provides translational relevance, especially in the context of inflammatory diseases like systemic juvenile idiopathic arthritis (sJIA) .

How does TMEM178 deficiency affect bone homeostasis?

Contrary to initial expectations based on its relationship with PLCγ2, Tmem178-/- mice display an osteopenic phenotype characterized by:

  • 35% decrease in trabecular bone volume

  • Significant trabecular thinning

  • Increased osteoclast surface normalized to bone surface

This phenotype results from enhanced osteoclast formation rather than changes in osteoblast function, as mineral apposition rate, bone formation rate, and RANKL/OPG mRNA levels are similar between Tmem178-/- and wild-type mice .

What is the relationship between TMEM178 and inflammatory bone diseases?

TMEM178 plays a significant role in inflammatory bone diseases:

  • Tmem178-/- mice show profound osteolysis following lipopolysaccharide (LPS) administration and in K/BxN arthritis models

  • In vitro studies demonstrate increased responsiveness to TNF-induced osteoclastogenesis in Tmem178-deficient cells

  • Reduced TMEM178 expression is observed in human CD14+ monocytes exposed to plasma from systemic juvenile idiopathic arthritis (sJIA) patients

  • This reduced expression correlates with excessive osteoclastogenesis in human cells

These findings suggest that TMEM178 acts in a negative feedback loop to restrain excessive osteoclastogenesis during inflammatory conditions .

How is TMEM178 expression regulated in pathological conditions?

The regulation of TMEM178 expression during pathological conditions, particularly in inflammatory settings, appears to be complex. While the exact transcriptional regulators are not fully elucidated in the search results, TMEM178 is identified as a PLCγ2 downstream target gene . In inflammatory conditions such as sJIA, TMEM178 expression is significantly reduced in monocytes, suggesting that inflammatory cytokines or other factors may suppress its expression. This downregulation correlates with enhanced osteoclastogenesis, indicating that maintaining TMEM178 expression might be protective against inflammatory bone loss .

How do TMEM178 and STIM1 interactions modulate ER calcium dynamics beyond simple binding?

The interaction between TMEM178 and STIM1 appears to be complex and context-dependent. While binding occurs primarily under resting conditions and decreases following calcium store depletion, the functional consequences of this interaction on STIM1 conformational changes, oligomerization, and recruitment of other proteins remain to be fully elucidated. Future research could explore:

  • The impact of TMEM178 on STIM1 localization to different ER microdomains

  • Effects on STIM1 post-translational modifications

  • How TMEM178 might influence the STIM1-Orai1 interaction kinetics

Notably, while TMEM178 interacts with STIM1, no direct interaction between TMEM178 and Orai1 has been detected, nor does TMEM178 appear to affect the STIM1-Orai1 coupling .

What is the resolution to the paradoxical bone phenotypes between PLCγ2-/- and Tmem178-/- mice?

A fascinating contradiction exists in the bone phenotypes of PLCγ2-/- and Tmem178-/- mice. Despite TMEM178 being a downstream target of PLCγ2, their phenotypes are opposite:

  • PLCγ2-/- mice show an osteopetrotic phenotype (increased bone mass)

  • Tmem178-/- mice display an osteopenic phenotype (decreased bone mass)

This paradox suggests complex regulation within the PLCγ2-TMEM178-calcium signaling axis. Potential explanations include:

  • PLCγ2 may regulate multiple downstream pathways with opposing effects on bone mass

  • TMEM178 might be regulated by additional factors beyond PLCγ2

  • Compensatory mechanisms might be activated differently in each knockout model

Research to resolve this paradox could provide valuable insights into the intricate regulation of bone homeostasis .

What therapeutic potential exists in targeting the TMEM178-STIM1 interaction for bone disorders?

Given TMEM178's role as a negative regulator of osteoclastogenesis, particularly in inflammatory conditions, the TMEM178-STIM1 interaction presents an intriguing therapeutic target. Potential approaches include:

  • Development of small molecules or peptides that mimic TMEM178's inhibitory effect on STIM1 function

  • Gene therapy approaches to restore TMEM178 expression in inflammatory arthritis

  • Screening for compounds that enhance endogenous TMEM178 expression or activity

The identification of specific residues mediating the TMEM178-STIM1 interaction (L212 and M216 in TMEM178, G225 in STIM1) provides structural information that could facilitate rational drug design . Moreover, the observation that TMEM178 expression is reduced in sJIA patients suggests that strategies to restore its expression might have therapeutic benefits in inflammatory bone diseases .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.