Recombinant Human Transmembrane protein 179 (TMEM179)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human TMEM179

Recombinant Human Transmembrane Protein 179 (TMEM179) represents a specialized protein product engineered for research applications focusing on understanding the structure, function, and potential therapeutic applications of the native human TMEM179. The recombinant form of this protein is produced through various expression systems and is typically tagged with molecular markers to facilitate detection and purification in laboratory settings . TMEM179 is also known by alternative names including C14orf90 and TMEM179A, reflecting its genomic location and classification within the transmembrane protein family . While the complete functional characterization of TMEM179 remains ongoing, emerging research has established its significance in neurological processes and cellular protection mechanisms, particularly against environmental toxins .

The development and availability of recombinant TMEM179 have been instrumental in advancing research into this protein's structure and function. By providing a reliable and consistent source of the protein, researchers can conduct detailed studies on its biochemical properties, interaction partners, and potential roles in both normal physiology and disease states. This has particular relevance in neuroscience research, where TMEM179 has shown promising implications for understanding and potentially treating neurotoxicity .

TMEM179 Gene and Native Protein Characteristics

The TMEM179 gene in humans is located on the long arm of chromosome 14, specifically mapping to position 14q32.33 on the reverse strand. The genomic sequence begins at 104,592,993 bp and extends to 104,604,983 bp, comprising a total of four exons that undergo alternative splicing to generate multiple protein isoforms . This genetic architecture provides the foundation for understanding the protein's diversity and potential functional adaptations.

The native TMEM179 protein has distinct structural characteristics that define its cellular role and interactions. The primary isoform consists of 233 amino acids with a predicted molecular weight of approximately 26 kDa and an isoelectric point of 5 . Notably, both human and frog (Xenopus laevis) TMEM179 proteins contain unusually high levels of phenylalanine, leucine, and tryptophan, while showing lower than normal levels of proline compared to other proteins from their respective organisms . The repetitive "LAFL" sequence appearing twice in both human and frog proteins suggests evolutionary conservation of functionally significant structural elements.

Alternative splicing of the TMEM179 gene results in four distinct isoforms, each with potentially specialized functions:

Isoform NameSize (Amino Acids)Exons UsedAccession Number
Isoform 12331, 2, 3, & 4NP_001273318.1
Isoform 21741, 2, & 3NP_001273319.1
Isoform 31021XP_011535048.1
Isoform 41312, 3, & 4XP_011535052.1

This diversity of isoforms suggests that TMEM179 may serve multiple cellular functions depending on the specific variant expressed . The structural analysis predicts TMEM179 contains four transmembrane regions, with the N-terminus positioned on the cytosolic side of the membrane, establishing its classification as an integral membrane protein with potential roles in signal transduction or transport across cellular compartments .

Production of Recombinant Human TMEM179

Recombinant Human TMEM179 is produced using various expression systems, each offering distinct advantages for different research applications. The selection of an appropriate expression system depends on factors including required protein yield, post-translational modifications, and intended experimental applications.

One common production method utilizes wheat germ expression systems, which provide a eukaryotic environment that supports proper protein folding while remaining free from mammalian cell contaminants . This cell-free approach is particularly valuable for membrane proteins like TMEM179 that may be toxic when overexpressed in living cells. Wheat germ-derived recombinant TMEM179 is typically purified to enable applications including Western blotting, ELISA, affinity purification, and antibody array experiments .

Alternative expression platforms include tobacco (Nicotiana tabacum) and cell-free protein synthesis (CFPS) systems, which offer additional options for producing research-grade TMEM179 . The tobacco-based system provides a plant eukaryotic environment that can support complex protein folding, while CFPS offers rapid production with minimal contamination concerns. Both systems produce recombinant TMEM179 suitable for Western blotting, ELISA, and SDS-PAGE applications .

Purification strategies for recombinant TMEM179 typically involve affinity chromatography using tagged versions of the protein. The incorporation of molecular tags serves dual purposes: facilitating purification while providing a means for detection in experimental settings. Common tagging approaches include GST (glutathione S-transferase) and Strep tags, each offering specific advantages for different applications . The GST tag enables glutathione-based affinity purification while providing enhanced solubility for the hydrophobic transmembrane protein. Strep tags offer highly specific purification with minimal impact on protein structure and function.

Biological Functions of TMEM179

The subcellular localization of TMEM179 provides important insights into its potential biological functions. Predictive analyses suggest that TMEM179 is primarily localized to the endoplasmic reticulum (ER), positioning it to participate in critical cellular processes including protein folding, quality control, and calcium homeostasis . This localization is consistent with the protein's multiple transmembrane domains and suggests functional roles in ER-associated cellular activities.

Recent research has uncovered a significant role for TMEM179 in maintaining mitochondrial functions, establishing its importance in cellular energy metabolism and oxidative stress responses . TMEM179 has been found to be highly expressed in oligodendrocyte precursor cells (OPCs), specialized neural cells responsible for producing myelin in the central nervous system . This expression pattern suggests TMEM179 may be particularly important in the development and function of myelinating cells, with potential implications for demyelinating disorders.

In a groundbreaking study investigating arsenic-induced neurotoxicity, TMEM179 was identified as a critical mediator in the cellular response to this environmental toxin . Exposure to arsenic was shown to decrease cell viability, increase oxidative stress, cause mitochondrial dysfunction, and ultimately lead to apoptosis in OPCs. The protective antioxidant N-acetyl-cysteine (NAC) was found to reverse these effects through mechanisms involving TMEM179 . This research established that TMEM179 plays an essential role in maintaining proper mitochondrial function and protecting neural cells from oxidative damage.

Further investigation revealed that protein kinase C beta (PKCβ) functions as a downstream effector through which TMEM179 regulates the expression of apoptosis-related proteins . This signaling pathway appears central to the protein's protective effects against neurotoxicity, highlighting TMEM179 as a potential therapeutic target for conditions involving mitochondrial dysfunction and oxidative stress in the nervous system.

TMEM179 in Disease Research

The emerging research on TMEM179 has significant implications for understanding and addressing neurological disorders, particularly those involving environmental toxins. Arsenic, a common environmental pollutant, has been identified as a major cause of neurotoxicity with poorly understood mechanisms of action. Recent studies have established TMEM179 as a key player in mediating arsenic-induced neurotoxicity and in the protective mechanisms against this damage .

Research using mouse oligodendrocyte precursor cells (OPCs) demonstrated that arsenic exposure significantly decreased cell viability while increasing oxidative stress, causing mitochondrial dysfunction, and triggering apoptosis . These effects represent serious threats to neurological health and development. TMEM179, which is highly expressed in OPCs, was shown to be a critical factor in maintaining mitochondrial functions under these challenging conditions .

The neuroprotective compound N-acetyl-cysteine (NAC), a thiol-based antioxidant, was found to counteract arsenic-induced neurotoxicity through mechanisms involving TMEM179 . NAC treatment effectively reversed the cytotoxic effects of arsenic, reducing oxidative stress and preventing mitochondrial dysfunction and apoptosis. This protective action was mediated through pathways involving TMEM179, establishing this protein as an essential component of cellular defense mechanisms against environmental toxins .

The downstream signaling cascade involves protein kinase C beta (PKCβ), through which TMEM179 regulates the expression of apoptosis-related proteins . This mechanistic insight provides a molecular framework for understanding how TMEM179 functions in neuroprotection and suggests potential approaches for therapeutic intervention in conditions involving neurotoxicity.

These findings highlight TMEM179 as a promising molecular target for the treatment of arsenic-induced neurotoxicity and potentially other conditions involving similar mechanisms of neural damage . By enhancing our understanding of the neurotoxic effects of arsenic exposure and the protective mechanisms of NAC, this research establishes TMEM179 as a key factor in neurological health and disease.

Applications of Recombinant TMEM179

Recombinant human TMEM179 serves multiple important functions in biomedical research, enabling studies that advance our understanding of this protein's role in normal physiology and disease states. Commercial availability of recombinant TMEM179 with various tags and from different expression systems provides researchers with flexible options for experimental design .

The primary research applications of recombinant TMEM179 include Western blotting, enzyme-linked immunosorbent assay (ELISA), affinity purification, antibody array, and SDS-PAGE . These techniques allow researchers to investigate protein expression, localization, interactions, and modifications under various experimental conditions. Western blotting applications are particularly valuable for examining TMEM179 expression in different tissues or in response to experimental manipulations, while ELISA enables quantitative analysis of protein levels in biological samples .

Commercial availability of recombinant TMEM179 includes multiple forms with different characteristics:

Catalog NumberTagExpression SystemSourceApplicationsPurity
ABIN1322992GST tagWheat germHumanWB, ELISA, AP, AAIn vitro wheat germ expression
ABIN3102106Strep tagCell-free protein synthesisHumanWB, ELISA, SDS-PAGE70-80% (SDS-PAGE, WB, SEC)
Custom optionsHis tagHEK-293 CellsHuman/MouseWB, SDS>90% (Bis-Tris Page, WB)

These commercial preparations provide researchers with standardized, reliable sources of TMEM179 for experimental use . The availability of different expression systems and tags allows selection of the most appropriate form for specific research applications, considering factors such as required purity, tag interference with function, and experimental compatibility.

Beyond current applications, recombinant TMEM179 holds potential for developing diagnostic tools and therapeutic approaches targeting neurotoxicity and related conditions. As research continues to elucidate the protein's role in neuroprotection and mitochondrial function, this recombinant protein may serve as a foundation for screening compounds that modulate TMEM179 activity or for developing antibody-based diagnostics to detect alterations in TMEM179 expression or localization associated with disease states .

Future Research Directions

The emerging understanding of TMEM179 opens numerous avenues for future research that could significantly advance our knowledge of this protein's functions and therapeutic potential. Several key knowledge gaps remain to be addressed, including the precise mechanisms through which TMEM179 influences mitochondrial function and how its different isoforms may serve specialized roles in various cellular contexts .

One promising research direction involves further characterization of the molecular interactions between TMEM179 and its downstream effector PKCβ in the context of neuroprotection . Detailed mapping of this signaling pathway could reveal potential points for therapeutic intervention in conditions involving neurotoxicity or mitochondrial dysfunction. Additionally, investigation of how TMEM179 expression and function change during neural development or in response to other environmental toxins beyond arsenic could broaden our understanding of its protective roles .

The four identified isoforms of TMEM179 represent another intriguing area for future study . Determining the specific functions, expression patterns, and regulatory mechanisms for each isoform could provide insights into how alternative splicing contributes to functional diversity for this protein. This knowledge might reveal isoform-specific roles in different tissues or developmental stages that could be targeted for therapeutic purposes.

Given the established role of TMEM179 in protection against arsenic-induced neurotoxicity, research exploring its potential involvement in other neurodegenerative conditions characterized by mitochondrial dysfunction and oxidative stress, such as Alzheimer's or Parkinson's disease, could yield valuable insights . The development of animal models with modified TMEM179 expression would provide essential tools for investigating these potential connections in vivo.

Finally, the application of advanced structural biology techniques to determine the three-dimensional structure of TMEM179 would significantly enhance our understanding of this protein's function. Detailed structural information could facilitate rational drug design approaches targeting TMEM179 or its interaction partners for therapeutic purposes in neurological conditions .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type preferences, please inform us, and we will prioritize developing the specified tag.
Synonyms
TMEM179; C14orf90; TMEM179A; Transmembrane protein 179; Transmembrane protein 179A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-233
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
TMEM179
Target Protein Sequence
MALNNFLFAQCACYFLAFLFSFVVVVPLSENGHDFRGRCLLFTEGMWLSANLTVQERERF TVQEWGPPAACRFSLLASLLSLLLAAAHAWRTLFFLCKGHEGSFFSAFLNLLVSAFVVFL VFIASTIVSVGFTMWCDTITEKGTVPHSCEELQDIDLELGVDNSAFYDQFAIAQFGLWAS WLAWLAITTLAFLKVYHNYRQEDLLDSLIHEKELLLARPSPRTSFQEEKSAVI
Uniprot No.

Target Background

Database Links

HGNC: 20137

KEGG: hsa:388021

STRING: 9606.ENSP00000340477

UniGene: Hs.652298

Protein Families
TMEM179 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the genomic location and structure of the human TMEM179 gene?

The human TMEM179 gene is located on the long arm of chromosome 14, specifically mapping to 14q32.33 on the reverse strand. The genomic sequence spans from 104,592,993 bp to 104,604,983 bp. TMEM179 contains four exons and has alternative names including "C14orf90" and "FLJ42486". The gene structure supports alternative splicing, resulting in four different protein isoforms with varying amino acid compositions and functional properties . When designing experiments targeting this gene, researchers should consider the specific genomic architecture to ensure proper primer design for amplification or modification procedures.

What are the key structural features of the TMEM179 protein?

Human TMEM179 is a 233 amino acid transmembrane protein with a predicted molecular weight of 26 kDa and an isoelectric point of 5. The protein contains four distinct transmembrane regions with the N-terminus oriented toward the cytosolic side of the membrane. A notable structural feature is the repetitive "LAFL" sequence that appears twice within the protein sequence, suggesting functional significance in protein-protein interactions or membrane anchoring . The protein exhibits unusual amino acid composition, containing higher than normal levels of phenylalanine, leucine, and tryptophan, with lower proline content compared to typical human proteins. These compositional peculiarities may influence protein folding dynamics and stability during recombinant expression.

What are the different isoforms of TMEM179 and how do they differ?

TMEM179 exists in four distinct isoforms resulting from alternative splicing of the pre-mRNA transcript. These variants differ in their exon composition and size:

Isoform NameSize (AA)Exons usedAccession Number
Transmembrane protein 179 Isoform 12331,2,3,& 4NP_001273318.1
Transmembrane protein 179 Isoform 21741,2,& 3NP_001273319.1
Transmembrane protein 179 Isoform 31021XP_011535048.1
Transmembrane protein 179 Isoform 41312,3,& 4XP_011535052.1

Each isoform likely serves distinct functions or operates in different cellular contexts. When designing recombinant expression systems, researchers should carefully consider which isoform best suits their experimental objectives . The full-length isoform 1 is typically recommended for initial characterization studies, while specific isoforms may be more appropriate for targeted functional analyses.

What mammalian expression systems are most effective for recombinant TMEM179 production?

Based on successful expression of similar transmembrane proteins, inducible expression systems in mammalian cells offer significant advantages for TMEM179 production. The T-REx 293 or HEK293S-TetR cell lines with CMV/TetO2 promoter systems (using pcDNA4 or pACMV vectors) have demonstrated success with other membrane proteins of similar complexity . These systems allow tight regulation of expression, which is crucial for membrane proteins that may be toxic when overexpressed. For crystallography-grade protein, the HEK293S-GnTI- cell line is recommended as it produces proteins with homogeneous N-glycans. Optimization should include testing different induction periods (24-72 hours) and inducer concentrations to balance protein yield with proper folding.

How can I optimize solubilization and purification of recombinant TMEM179?

Successful solubilization of TMEM179 will likely require careful detergent screening. Begin with mild detergents like DDM (n-dodecyl-β-D-maltoside) or LMNG (lauryl maltose neopentyl glycol) at concentrations just above their critical micelle concentration. Since TMEM179 is predicted to localize to the endoplasmic reticulum , consider using a purification strategy that includes an initial enrichment of ER membranes before detergent solubilization. For affinity purification, a C-terminal tag (such as His8 or FLAG) is recommended over N-terminal tags to avoid interference with proper membrane insertion. Include cholesterol supplementation in purification buffers, as many transmembrane proteins require cholesterol for stability, similar to what has been observed with serotonin transporters . Protein quality should be assessed by size-exclusion chromatography to verify monodispersity and proper folding.

What are the critical factors affecting expression yield and functional folding of TMEM179?

Several interdependent factors govern successful expression of complex membrane proteins like TMEM179:

  • N-glycosylation: Examine potential N-glycosylation sites as these modifications often contribute to proper folding of membrane proteins. If TMEM179 is glycosylated, expression in cells with impaired glycosylation (like HEK293S-GnTI-) may reduce heterogeneity for structural studies but could affect folding efficiency .

  • Molecular chaperones: Consider co-expression with molecular chaperones like calnexin that assist in membrane protein folding, especially for proteins with N-glycosylation sites .

  • Lipid environment: TMEM179's localization to the ER suggests specific lipid requirements. Supplementation with cholesterol or other lipids during expression and purification may significantly improve stability .

  • Induction parameters: Slower expression at lower temperatures (30°C instead of 37°C) often improves folding efficiency at the expense of total yield. This trade-off should be empirically optimized for TMEM179.

  • mRNA stability and codon optimization: Design expression constructs with optimal codon usage for the host cell line while avoiding rare codons that could introduce translational pauses affecting folding dynamics.

What approaches can be used to investigate the potential role of TMEM179 in the nervous system?

Given TMEM179's predicted function in the nervous system , several complementary approaches can elucidate its role:

  • Cell-type specific expression profiling: Perform single-cell RNA sequencing in neural tissues to identify specific neuron populations expressing TMEM179. Compare expression patterns with established neuronal markers to pinpoint potential functional networks.

  • Subcellular localization studies: Beyond confirmation of ER localization, investigate whether TMEM179 is enriched in specific neuronal compartments using immunofluorescence microscopy with subcellular markers. Co-localization with synaptic vesicle proteins or specific ion channels may provide functional insights.

  • Protein interaction networks: Employ BioID or APEX2 proximity labeling in neuronal cultures expressing tagged TMEM179 to identify interacting proteins within its native cellular environment.

  • Functional knockdown/knockout studies: Utilize CRISPR-Cas9 or RNAi approaches in neuronal cultures to assess effects on neuronal development, electrophysiological properties, and response to various stimuli. This should be followed by rescue experiments with different TMEM179 isoforms to confirm specificity.

  • Calcium imaging and electrophysiology: Since many transmembrane proteins in neurons modulate ion flux or signaling, perform calcium imaging or patch-clamp electrophysiology in neurons with modified TMEM179 expression to assess potential roles in neuronal signaling.

How can the significance of the repetitive "LAFL" sequence in TMEM179 be experimentally evaluated?

The repetitive "LAFL" sequence appearing twice in both human and frog TMEM179 proteins suggests evolutionary conservation and potential functional significance . To investigate this:

  • Site-directed mutagenesis: Generate recombinant TMEM179 variants with mutations in one or both LAFL sequences, followed by comparative functional, structural, and interaction assays.

  • Peptide competition assays: Synthesize peptides containing the LAFL motif to compete with potential binding partners of TMEM179, which can help identify specific interactions mediated by this sequence.

  • Structural studies: If pursuing cryo-EM or crystallography of TMEM179, pay particular attention to the structural context of the LAFL repeats to determine if they form specific recognition motifs.

  • Molecular dynamics simulations: Conduct computational modeling of TMEM179 to examine how the LAFL sequences might contribute to protein dynamics, particularly their potential role in membrane interactions or protein-protein binding interfaces.

  • Evolutionary conservation analysis: Perform comprehensive sequence alignment across diverse species to evaluate the conservation pattern of the LAFL motif, which can provide insights into its evolutionary importance.

What strategies should be employed for structural determination of TMEM179?

Structural characterization of TMEM179 will require careful consideration of its membrane-embedded nature:

  • Expression system selection: For cryogenic electron microscopy (cryo-EM) studies, expression in HEK293S-GnTI- cells has proven successful for other membrane proteins like rhodopsin and β2-adrenergic receptors, yielding 3-9 mg/L in bioreactor systems . This system produces glycoproteins with homogeneous glycans beneficial for structural studies.

  • Detergent and lipid nanodisc screening: Screen multiple detergents and reconstitution into various lipid nanodiscs to identify conditions that maintain native conformation. Given TMEM179's predicted four transmembrane domains, smaller detergents like LMNG or GDN may be most appropriate.

  • Thermal stability assays: Employ differential scanning fluorimetry to screen stabilizing conditions (pH, salt, additives) before committing to large-scale purification for structural studies.

  • Antibody fragment co-crystallization: Generate and screen single-chain variable fragments (scFvs) or nanobodies that bind to TMEM179, which can facilitate crystallization by providing additional crystal contacts for membrane proteins.

  • Cryo-EM approach: Given recent advances in single-particle cryo-EM for membrane proteins, this approach may be preferable to crystallography, especially if TMEM179 forms oligomers or complexes that increase molecular weight beyond the typical size limitation.

How might TMEM179 be involved in disease pathways, and what methodologies can explore these connections?

Although direct disease associations with TMEM179 haven't been extensively documented, other transmembrane proteins like TMEM175 have been implicated in neurodegenerative conditions such as Parkinson's disease . To explore potential disease connections:

  • Genetic association studies: Analyze existing genomic databases to identify single nucleotide polymorphisms or copy number variations in TMEM179 that correlate with disease phenotypes, particularly neurological disorders.

  • Patient-derived cell models: Generate induced pluripotent stem cells (iPSCs) from patients with neurological disorders, differentiate them into relevant neural cell types, and compare TMEM179 expression, localization, and function with healthy controls.

  • Multi-omics approach: Implement integrated lipidomic, metabolomic, and proteomic analyses similar to those used for TMEM175 in Parkinson's disease to identify altered pathways associated with TMEM179 dysregulation.

  • Functional complementation assays: Determine if TMEM179 overexpression can rescue phenotypes observed in cellular models of neurodegenerative diseases, particularly those affecting lysosomes, autophagy, or mitochondrial function.

  • Animal models: Develop transgenic mouse models with TMEM179 knockout or overexpression to assess behavioral, electrophysiological, and biochemical phenotypes relevant to human neurological conditions.

What are the challenges and solutions for measuring TMEM179 activity in experimental systems?

Measuring activity of transmembrane proteins with unclear functions presents significant challenges:

  • Electrophysiological characterization: If TMEM179 functions as an ion channel or transporter, employ patch-clamp electrophysiology in reconstituted systems or overexpression models. Begin with whole-cell recordings followed by single-channel analyses if activity is detected.

  • Reporter systems: Design fluorescent or luminescent reporter systems that respond to changes in ion concentrations, membrane potential, or protein interactions that might be mediated by TMEM179.

  • Cargo trafficking assays: If TMEM179 is involved in intracellular trafficking or sorting (suggested by its ER localization ), use fluorescently-tagged cargo proteins to track their movement in cells with modified TMEM179 expression.

  • Chemical crosslinking mass spectrometry: Identify dynamic protein interactions by crosslinking followed by mass spectrometry in native versus stimulated conditions to detect activity-dependent interaction partners.

  • Activity-based protein profiling: Develop activity-based probes that can covalently label TMEM179 in its active state to quantify the proportion of functional protein in different experimental conditions.

How can emerging gene expression technologies advance our understanding of TMEM179?

Recent advances in understanding the molecular basis of gene expression offer opportunities for TMEM179 research :

  • Ribosome profiling: Apply ribosome footprinting to study translational regulation of TMEM179, particularly investigating potential translational pauses that might impact protein folding or post-translational modifications.

  • Single-molecule imaging techniques: Implement techniques used to study mRNA delivery to ribosomes to visualize TMEM179 mRNA localization and translation dynamics, potentially revealing tissue-specific regulatory mechanisms.

  • CRISPR activation/interference: Apply CRISPRa/CRISPRi technologies to modulate endogenous TMEM179 expression in relevant cell types, providing insights into physiological functions without overexpression artifacts.

  • Spatial transcriptomics: Integrate spatial expression data to create comprehensive maps of TMEM179 expression across developmental stages and tissue types, which can inform hypotheses about function.

  • Long-read sequencing: Employ nanopore or PacBio sequencing to characterize full-length TMEM179 transcripts, potentially identifying novel isoforms or splice variants missed by short-read sequencing.

What considerations are important when designing antibodies or detection systems for TMEM179?

Developing specific detection tools for TMEM179 requires careful consideration:

  • Epitope selection: Target unique extracellular or cytoplasmic loops rather than transmembrane regions. Based on the predicted topology with four transmembrane domains , the N-terminus, C-terminus, and two intervening loops present potential epitope regions.

  • Isoform specificity: Design antibodies that can distinguish between the four known isoforms by targeting regions present in specific splice variants.

  • Validation strategy: Implement a multi-tiered validation approach including western blotting of recombinant protein, immunoprecipitation coupled with mass spectrometry, and comparison of detection in wild-type versus TMEM179-knockout cells.

  • Post-translational modification awareness: Consider potential N-glycosylation sites when designing antibodies, as glycan modifications might obscure epitopes in the native protein.

  • Live-cell labeling: For tracking TMEM179 dynamics in living cells, develop cell-impermeable antibodies targeting extracellular epitopes or consider enzyme-mediated approaches like APEX2 or HaloTag systems for specific labeling.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.