Recombinant Human Transmembrane protein 184C (TMEM184C)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipment, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to collect the contents at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
TMEM184C; TMEM34; PRO1355; Transmembrane protein 184C; Transmembrane protein 34
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-438
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
TMEM184C
Target Protein Sequence
MPCTCTWRNWRQWIRPLVAVIYLVSIVVAVPLCVWELQKLEVGIHTKAWFIAGIFLLLTI PISLWVILQHLVHYTQPELQKPIIRILWMVPIYSLDSWIALKYPGIAIYVDTCRECYEAY VIYNFMGFLTNYLTNRYPNLVLILEAKDQQKHFPPLCCCPPWAMGEVLLFRCKLGVLQYT VVRPFTTIVALICELLGIYDEGNFSFSNAWTYLVIINNMSQLFAMYCLLLFYKVLKEELS PIQPVGKFLCVKLVVFVSFWQAVVIALLVKVGVISEKHTWEWQTVEAVATGLQDFIICIE MFLAAIAHHYTFSYKPYVQEAEEGSCFDSFLAMWDVSDIRDDISEQVRHVGRTVRGHPRK KLFPEDQDQNEHTSLLSSSSQDAISIASSMPPSPMGHYQGFGHTVTPQTTPTTAKISDEI LSDTIGEKKEPSDKSVDS
Uniprot No.

Target Background

Function
This protein is a potential tumor suppressor and may play a role in cell growth regulation.
Gene References Into Functions
  1. Recent cDNA microarray analysis identified transmembrane protein 34 (TMEM34) as down-regulated in anaplastic thyroid cancer cell lines compared to normal thyroid tissues. Transfection of TMEM34 into KTA2 cells resulted in cell growth inhibition. PMID: 17072649
Database Links

HGNC: 25587

OMIM: 613937

KEGG: hsa:55751

UniGene: Hs.203896

Protein Families
TMEM184 family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Widely expressed with higher expression in lung, kidney, spleen, pancreas, thymus, prostate, testis, ovary, small intestine and thyroid.

Q&A

What is TMEM184C and what are its known aliases?

TMEM184C (Transmembrane protein 184C) is a multi-transmembrane domain protein also known by the aliases TMEM34 and PRO1355. It has been identified through cDNA microarray analysis as being down-regulated in anaplastic thyroid cancers compared to normal thyroid tissues . The human TMEM184C protein is identified by UniProt ID Q9NVA4 and is considered a possible tumor suppressor that may play a role in regulating cell growth .

What is currently known about TMEM184C gene expression in normal vs. cancer tissues?

TMEM184C was identified in a cDNA microarray analysis as being down-regulated in anaplastic thyroid cancers compared to normal thyroid tissues . Additionally, TMEM184C protein expression is lower in cell lines derived from anaplastic thyroid cancers compared to normal thyroid tissues or cell lines based on other types of thyroid cancers . This differential expression pattern supports its potential role as a tumor suppressor specifically in anaplastic thyroid cancer, which is one of the most lethal forms of cancer .

What is the evidence supporting TMEM184C's role as a tumor suppressor?

The evidence supporting TMEM184C's tumor suppressor role includes:

  • Reduced expression in anaplastic thyroid cancers compared to normal thyroid tissues

  • Lower protein expression in anaplastic thyroid cancer cell lines compared to normal thyroid tissues or other thyroid cancer cell lines

  • Experimental evidence showing that transfection of TMEM34 (TMEM184C) into KTA2 cells led to inhibition of cell growth

These findings collectively suggest that TMEM184C normally functions to suppress cell proliferation, and its loss may contribute to cancer development or progression.

How does the structure of TMEM184C compare to other transmembrane proteins in its family?

While the search results don't provide detailed structural information specifically for TMEM184C, insights can be gained by examining related proteins. Unlike TMEM18, which has been characterized as having four transmembrane segments with both N and C termini located in the cytoplasm , the exact membrane topology of TMEM184C remains to be determined. TMEM184C appears to be distinct from TMEM184B, which has been associated with neurodevelopmental disorders , suggesting functional divergence within this protein family despite potential structural similarities.

What antibodies and detection methods are available for studying TMEM184C?

Several validated reagents are available for detecting TMEM184C in research applications:

MethodReagentConcentrationSpecies ReactivityNotes
Western Blotab1067191 μg/mLMousePredicted band size: 50 kDa
IHC-Pab1067195 μg/mlMouseValidated on paraffin-embedded tissues
ICC/IFab10671920 ug/mLMouseValidated for immunofluorescence
Control FragmentRP-101430100x molar excessHumanFor blocking experiments (aa 376-437)

When using antibodies, it's recommended to validate specificity through blocking experiments with recombinant protein control fragments, pre-incubating the antibody-protein mixture for 30 minutes at room temperature .

What experimental approaches can be used to study TMEM184C function in cell models?

Based on research approaches documented for TMEM184C and related proteins, several experimental strategies can be employed:

  • Overexpression studies: Transfection of TMEM184C into appropriate cell lines (such as KTA2 cells) to examine effects on cell growth and other cancer-related phenotypes

  • Loss-of-function studies: RNA interference (siRNA/shRNA) or CRISPR-Cas9 approaches targeting TMEM184C to assess functional consequences

  • Protein interaction studies: Techniques such as co-immunoprecipitation or proximity labeling methods to identify binding partners, similar to approaches used for other transmembrane proteins

  • Localization studies: Immunofluorescence microscopy using validated antibodies such as ab106719 to determine subcellular distribution

  • Structure-function analyses: Site-directed mutagenesis approaches similar to those used for TMEM184B to identify functional domains

What are the best cellular models for studying TMEM184C in cancer research?

Based on available research, optimal cellular models include:

  • Anaplastic thyroid cancer cell lines, which show reduced TMEM184C expression compared to other thyroid cancer types

  • KTA2 cells, which have been successfully used for TMEM184C transfection experiments

  • Comparative models including:

    • Normal thyroid cell lines

    • Cell lines derived from other thyroid cancer subtypes

    • Isogenic cell lines with engineered TMEM184C expression levels

When designing experiments, it's important to characterize baseline TMEM184C expression in your chosen model system to interpret results appropriately.

How should recombinant TMEM184C protein fragments be used in experimental validation?

Recombinant TMEM184C protein fragments, such as the human TMEM184C (aa 376-437) control fragment, serve important roles in experimental validation:

  • Antibody validation: Pre-incubate antibodies with a 100x molar excess of the protein fragment control for 30 minutes at room temperature before immunostaining procedures to confirm specificity

  • Positive controls: Include purified protein fragments as standards in Western blot or other quantitative assays

  • Competition assays: Use increasing concentrations of recombinant fragments to demonstrate specific displacement of antibody binding

  • Domain mapping: Utilize different fragments representing various protein domains to identify functional regions

When working with recombinant fragments, researchers should carefully consider the fragment's coverage of the full-length protein and its potential structural limitations.

What is known about TMEM184C's molecular interactions and signaling pathways?

Unlike TMEM18, which has been shown to interact with nuclear pore complex proteins such as NDC1 and AAAS , specific TMEM184C interaction partners have not been definitively identified in the available search results. This represents an important area for future investigation to understand the mechanistic basis of TMEM184C's tumor suppressive effects.

How can researchers differentiate between the functions of TMEM184C and other related proteins?

To differentiate between TMEM184C and related proteins such as TMEM184B or TMEM18, researchers should consider these approaches:

  • Specificity controls: Ensure antibody specificity through validation with recombinant proteins and knockdown/knockout controls

  • Comparative expression analysis: Analyze expression patterns across different tissues and disease states

  • Rescue experiments: Perform cross-complementation studies to determine functional overlap (similar to approaches used for TMEM184B )

  • Domain swapping: Create chimeric proteins to identify functionally important regions

  • Evolutionary analysis: Conduct phylogenetic studies to understand evolutionary relationships and potential functional divergence

This systematic approach will help delineate the unique functions of TMEM184C compared to other transmembrane proteins.

What techniques can be used to study post-translational modifications of TMEM184C?

Although the search results don't provide specific information about TMEM184C post-translational modifications, researchers can employ these techniques to investigate this aspect:

  • Mass spectrometry: Particularly phosphoproteomics, glycoproteomics, or global PTM profiling approaches

  • Site-directed mutagenesis: Systematic mutation of potential modification sites followed by functional assays

  • Western blotting: Using modification-specific antibodies (phospho-specific, etc.)

  • In vitro modification assays: To identify enzymes responsible for specific modifications

  • Inhibitor studies: Using compounds that block specific modification pathways to assess functional consequences

Understanding TMEM184C's post-translational regulation could provide important insights into how its tumor suppressor function is controlled.

How might structural analysis inform our understanding of TMEM184C function?

Structural analysis of TMEM184C would significantly advance our understanding of its function. Based on approaches used for related proteins , researchers could consider:

  • Computational structure prediction: Similar to the AlphaFold approach used for TMEM184B variants , which can provide insights into protein topology and potential functional domains

  • Site-directed mutagenesis: Systematic mutation of conserved residues to identify functionally important regions

  • Membrane topology mapping: Experimental determination of transmembrane segments and their orientation

  • Domain identification: Bioinformatic and experimental approaches to define functional domains

  • Structure-guided drug design: If sufficient structural information becomes available, rational design of modulators of TMEM184C function

For instance, with TMEM184B, structural modeling suggested that disease-associated variants alter protein stability , and similar approaches could be applied to understand TMEM184C variants.

How might TMEM184C expression patterns be used as biomarkers in cancer diagnostics?

TMEM184C's differential expression between anaplastic thyroid cancers and normal thyroid tissue suggests potential utility as a diagnostic or prognostic biomarker . Researchers investigating this application should consider:

  • Assay development: Optimize immunohistochemical or molecular protocols for detecting TMEM184C in clinical samples

  • Validation cohorts: Assess expression patterns across large, well-characterized patient cohorts

  • Multimarker panels: Evaluate TMEM184C in combination with other thyroid cancer biomarkers

  • Correlation studies: Analyze associations between TMEM184C expression levels and clinical outcomes

  • Implementation research: Develop standardized protocols for potential clinical application

The notable downregulation in anaplastic thyroid cancer compared to other thyroid cancer types suggests TMEM184C might be particularly valuable for distinguishing this aggressive cancer subtype .

What are the methodological challenges in studying TMEM184C variants in patient populations?

Researchers investigating TMEM184C variants face several methodological challenges:

  • Rare variant detection: Developing sensitive sequencing approaches to identify low-frequency variants

  • Functional annotation: Establishing high-throughput methods to assess variant effects on protein function

  • Model systems: Creating appropriate cellular or animal models expressing patient-derived variants

  • Population stratification: Accounting for genetic background differences in association studies

  • Variant classification: Developing criteria to distinguish pathogenic from benign variants, similar to approaches used for TMEM184B

Lessons can be drawn from studies of TMEM184B, where researchers successfully characterized pathogenic variants through a combination of computational modeling, in vitro studies, and in vivo zebrafish models .

What approaches could be used to restore TMEM184C function as a potential therapeutic strategy?

If TMEM184C indeed functions as a tumor suppressor , restoring its function could represent a therapeutic approach for cancers with reduced TMEM184C expression. Research strategies might include:

  • Gene therapy: Viral vector-mediated delivery of functional TMEM184C to cancer cells

  • Small molecule screening: Identification of compounds that stabilize remaining TMEM184C protein or enhance its function

  • Transcriptional activation: CRISPR-activation or small molecule approaches to upregulate endogenous TMEM184C expression

  • Synthetic lethality: Identification of genes that, when inhibited, cause selective death of cells with low TMEM184C expression

  • Peptide mimetics: Development of peptides that mimic essential functional domains of TMEM184C

Experimental approaches similar to those used for other tumor suppressors could be adapted for TMEM184C-targeted therapeutics.

How should researchers design studies to investigate TMEM184C's role across different cancer types?

To comprehensively investigate TMEM184C's role beyond anaplastic thyroid cancer, researchers should consider:

  • Expression profiling: Systematic analysis of TMEM184C expression across cancer types using transcriptomic and proteomic approaches

  • Meta-analysis: Integration of publicly available datasets to identify cancer types with altered TMEM184C expression

  • Functional screening: CRISPR-based approaches to identify cancer types dependent on TMEM184C status

  • Comparative oncology: Investigation of TMEM184C in animal cancer models

  • Mechanistic studies: Identification of tissue-specific interaction partners or regulatory mechanisms

This multifaceted approach would help determine whether TMEM184C's apparent tumor suppressor role in anaplastic thyroid cancer extends to other malignancies.

What single-cell approaches could advance our understanding of TMEM184C biology?

Single-cell technologies offer powerful tools for investigating TMEM184C biology:

  • Single-cell RNA sequencing: To identify cell populations with distinct TMEM184C expression patterns within heterogeneous tissues

  • Single-cell proteomics: To analyze TMEM184C protein levels and modifications at single-cell resolution

  • Spatial transcriptomics: To map TMEM184C expression in the tissue microenvironment

  • CITE-seq: To simultaneously analyze TMEM184C surface expression and transcriptional profiles

  • Lineage tracing: To track the fate of TMEM184C-expressing cells during development or disease progression

These approaches could reveal previously unrecognized heterogeneity in TMEM184C expression and function across cell types.

How might CRISPR-based technologies enhance TMEM184C functional studies?

CRISPR technologies can significantly advance TMEM184C research through:

  • Knockout models: Generation of complete and conditional TMEM184C knockout cell lines and animal models

  • Knockin strategies: Introduction of reporter tags or specific mutations to study localization and variant effects

  • CRISPRa/CRISPRi: Modulation of TMEM184C expression levels without genetic modification

  • Base editing: Precise introduction of specific mutations to model variants

  • CRISPR screens: Identification of genes that synthetically interact with TMEM184C

Similar approaches have proven valuable for studying other transmembrane proteins and could be adapted for TMEM184C functional analysis.

What comparative genomic approaches would help elucidate TMEM184C evolution and conservation?

Understanding TMEM184C's evolutionary history could provide insights into its fundamental functions:

  • Phylogenetic analysis: Comparison of TMEM184C sequences across species to identify conserved regions

  • Synteny analysis: Examination of genomic context to understand evolutionary relationships

  • Positive selection analysis: Identification of residues under selective pressure

  • Paralog comparison: Analysis of TMEM184 family members (e.g., TMEM184B ) to understand functional divergence

  • Molecular clock studies: Estimation of when gene duplication events occurred

This evolutionary perspective could reveal functionally critical domains that have been conserved through selective pressure.

How can systems biology approaches integrate TMEM184C into broader cellular networks?

Systems biology approaches can place TMEM184C within its broader functional context:

  • Protein-protein interaction mapping: Techniques such as BioID or APEX proximity labeling to identify the TMEM184C interactome

  • Network analysis: Integration of transcriptomic, proteomic, and functional data to position TMEM184C within cellular networks

  • Multi-omics integration: Correlation of TMEM184C status with global cellular parameters

  • Mathematical modeling: Development of predictive models for TMEM184C's role in cell growth regulation

  • Perturbation biology: Systematic analysis of how TMEM184C alterations affect cellular responses to various stimuli

These approaches could reveal unexpected connections between TMEM184C and other cellular processes, potentially explaining its role in tumor suppression .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.