Recombinant Human Transmembrane protein 18 (TMEM18)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
TMEM18; Transmembrane protein 18
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-140
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
TMEM18
Target Protein Sequence
MPSAFSVSSFPVSIPAVLTQTDWTEPWLMGLATFHALCVLLTCLSSRSYRLQIGHFLCLV ILVYCAEYINEAAAMNWRLFSKYQYFDSRGMFISIVFSAPLLVNAMIIVVMWVWKTLNVM TDLKNAQERRKEKKRRRKED
Uniprot No.

Target Background

Function
TMEM18 is a transcription repressor and sequence-specific single- and double-stranded DNA binding protein, exhibiting a preference for GCT and CTG repeat sequences. It modulates cell migration, enhancing the migration capabilities of glioma-specific neural stem cells (NSCs) and neural precursor cells (NPCs).
Gene References Into Functions

TMEM18's Role in Obesity and Related Phenotypes:

  1. Studies have linked TMEM18 (rs6548238), NEGR1 (rs2815752), and BDNF (rs10767664 and rs6265) polymorphisms to anthropometric phenotypes in children aged 3.5 years and, in some cases, 1 year. (PMID: 27005443)
  2. TMEM18 variants have been associated with obesity and body mass index (BMI). (PMID: 26365393, 24951660, 24763707)
  3. While some studies suggest a link between TMEM18 variants and obesity risk, others have found no significant association, particularly in specific populations. (PMID: 23505181, 22466342, 21750520, 20628085, 21720444)
  4. TMEM18 expression levels correlate with obesity and glucose metabolism phenotypes. (PMID: 24763707)
  5. Research indicates a potential regulatory role for TMEM18 in adipocyte differentiation and biology. (PMID: 23229156)
  6. A strong positive correlation exists between TMEM18 expression and body weight in the prefrontal cortex (PFC), suggesting a role in higher-order feeding functions. (PMID: 21952719)
  7. TMEM18 localizes to the nuclear membrane and binds DNA in a sequence-specific manner, potentially repressing transcription. (PMID: 21980424)
  8. The TMEM18 rs6548238 risk allele is associated with higher BMI, waist circumference, and total body fat. (PMID: 19910938)
  9. TMEM18's involvement in both childhood and adult obesity has been noted, with its presence in various brain regions, including the hypothalamus and brainstem. (PMID: 20380707)
  10. TMEM18 overexpression is linked to glioma. (PMID: 18559506)
Database Links

HGNC: 25257

OMIM: 613220

KEGG: hsa:129787

STRING: 9606.ENSP00000281017

UniGene: Hs.43899

Protein Families
TMEM18 family
Subcellular Location
Cytoplasm. Nucleus membrane; Multi-pass membrane protein.

Q&A

What is the current understanding of TMEM18's membrane topology?

While TMEM18 was previously described as a three-transmembrane protein, recent structural analyses have revealed it actually contains four transmembrane domains. Deep phylogenetic analysis using sequence profile-to-profile homology showed remote but clear homology to various ion channels, including fungal transient receptor potential channels and bacterial mechanosensitive ion channels . Experimental validation using differential detergent permeabilization (TX100 vs. digitonin) with FLAG-tagged TMEM18 confirmed that both the N and C termini of the protein are located within the cytoplasm, supporting the four-transmembrane model . This correction to the protein's topology has significant implications for understanding its functional mechanisms.

Where is TMEM18 primarily expressed in the central nervous system?

TMEM18 is widely expressed throughout the brain but shows particularly notable expression in hypothalamic nuclei. RNA-Seq analysis of laser-capture microdissected tissue has demonstrated TMEM18 expression in multiple hypothalamic regions, including the arcuate nucleus, ventromedial nucleus, paraventricular nucleus (PVN), and dorsomedial nucleus . Quantitative PCR analysis has shown that expression in the PVN is regulated by nutritional state, with a significant decrease (approximately 70%) observed after 48-hour fasting, which can be restored to fed levels by leptin administration during the fast .

What protein interactions have been identified for TMEM18?

Affinity purification and mass spectrometry have identified 244 proteins uniquely interacting with FLAG-TMEM18 in HEK293 cells. Most notably, TMEM18 interacts with three members of the nuclear pore complex: NDC1, AAAS, and NUP35/53 . These interactions were confirmed using biomolecular immunofluorescence complementation (BiFC) assays. The association with nuclear pore proteins suggests TMEM18 may have functions related to nuclear transport or nuclear membrane organization . These interactions provide important clues for understanding TMEM18's cellular functions beyond its potential role as an ion channel.

How does genetic manipulation of TMEM18 affect body weight in animal models?

Germline loss and tissue-specific overexpression of TMEM18 have opposing effects on body weight:

Knockout Model: Male mice with homozygous disruption of TMEM18 (tm1a allele) show significantly increased body weight starting at 14 weeks of age, with an average increase of 1.9g compared to wild-type littermates by 16 weeks . This weight gain results from increases in both fat mass and lean mass, with notable enlargement of gonadal white adipose tissue (gWAT) and brown adipose tissue (BAT) .

Targeted Overexpression: Conversely, bilateral adeno-associated viral vector (AAV)-mediated overexpression of TMEM18 in the paraventricular nucleus (PVN) of adult male mice results in significantly reduced weight gain. Six weeks after surgery, control mice gained 2.7g while TMEM18-overexpressing mice gained only 0.9g . Similar resistance to weight gain was observed when these mice were placed on a high-fat diet immediately after stereotactic surgery .

These bidirectional effects strongly support TMEM18's direct involvement in body weight regulation through central nervous system mechanisms.

What metabolic parameters are affected by TMEM18 manipulation?

TMEM18 affects multiple aspects of energy balance:

Food Intake: AAV-mediated overexpression of TMEM18 in the PVN leads to a significant reduction in food intake at 2 weeks post-surgery, contributing to reduced weight gain. Interestingly, this hypophagia appears to resolve by 6 weeks post-surgery .

Energy Expenditure: At 6 weeks post-surgery, mice overexpressing TMEM18 in the PVN show significantly increased energy expenditure compared to controls (ANCOVA analysis with correction for body weight differences, P=0.03) .

Body Composition: TMEM18 manipulation affects both fat and lean mass. Overexpression results in significant reductions in both total and fat mass in mice on high-fat diets .

These findings indicate that TMEM18 influences body weight through multiple mechanisms affecting both energy intake and expenditure.

How is TMEM18 expression regulated by nutritional status?

TMEM18 expression in the hypothalamus demonstrates nutritional responsiveness:

  • 48-hour fasting decreases PVN TMEM18 expression by approximately 70%

  • Leptin administration during fasting restores TMEM18 expression to fed levels

These changes suggest TMEM18 is part of the hypothalamic circuitry that responds to energy status signals like leptin. Interestingly, a separate RNA-Seq analysis of 24-hour fasted mice did not show statistically significant changes in TMEM18 expression in any of the four hypothalamic nuclei examined, suggesting that longer fasting periods may be necessary to observe robust changes in expression .

What are effective methods for manipulating TMEM18 expression in vivo?

Two primary approaches have been validated for TMEM18 manipulation:

Germline Knockout: The European Conditional Mouse Mutagenesis Program (EUCOMM) has generated knockout mice carrying the mutant allele tm1a(EUCOMM)Wtsi Tmem18, which disrupts exon 2 of TMEM18. Homozygous mice show very low residual TMEM18 transcript levels in the hypothalamus (2.1% ±1.4%), while heterozygous mice show approximately 50% reduction in transcript expression . This model provides a useful tool for studying complete or partial loss of TMEM18 function.

AAV-Mediated Overexpression: Bilateral stereotactic injection of adeno-associated viral vectors expressing TMEM18 cDNA (AAV-T18) into specific hypothalamic nuclei, particularly the PVN, has been shown to effectively increase local TMEM18 expression (approximately 2-fold increase compared to controls) . This approach allows for region-specific manipulation of TMEM18 in adult animals, avoiding developmental compensations that might occur in germline models.

What techniques are effective for studying TMEM18 protein interactions?

Two complementary approaches have proven useful:

Affinity Purification-Mass Spectrometry: Immunoprecipitation of FLAG-tagged TMEM18 followed by mass spectrometry analysis has successfully identified interacting proteins. This approach identified 244 proteins uniquely pulled down with FLAG-TMEM18 in HEK293 cells .

Biomolecular Fluorescence Complementation (BiFC): This technique has been used to confirm specific interactions between TMEM18 and nuclear pore complex proteins. BiFC involves splitting YFP into two non-fluorescent fragments (YN and YC) that are fused to potentially interacting proteins. Protein interaction brings the fragments together, reconstituting YFP fluorescence .

How can TMEM18 protein topology be experimentally determined?

The four-transmembrane domain structure of TMEM18 was confirmed using a differential detergent permeabilization approach:

  • N-terminal FLAG-tagged TMEM18 construct was transfected into Cos cells

  • Cells were treated with either:

    • Triton X-100 (TX100): permeabilizes all cellular membranes

    • Digitonin (40 μg/mL): selectively permeabilizes only the plasma membrane

  • Protein localization was detected using:

    • FLAG antibody to detect the N-terminus

    • TMEM18 antibody (against C-terminus amino acids 120-134)

  • Control antibodies for validation:

    • Lamin B (localized inside nuclear membrane): detected only with TX100

    • Calnexin (spans nuclear membrane, C-terminus in cytoplasm): detected with both reagents

Both N and C termini of TMEM18 were detected with digitonin permeabilization, indicating both ends are located in the cytoplasm and confirming the four-transmembrane model .

What structural homologies might inform TMEM18's function?

Bioinformatic analyses have revealed potential structural insights:

Sequence profile-to-profile homology searches identified remote but clear homology between TMEM18 and various ion channels, including:

  • Fungal transient receptor potential ion channels (PF06011)

  • Bacterial mechanosensitive ion channels (PF12794)

  • Voltage-gated sodium channel from Caldalkalibacillus thermarum

  • Ion transport protein from Arcobacter butzleri

Based on homology to the C. thermarum channel, a tentative model suggests TMEM18 may form a tetrameric structure similar to the A. butzleri channel, with each subunit containing four transmembrane domains . The conserved charged tip of the C-terminal helices would be positioned outside the membrane and potentially participate in pore opening.

These structural similarities suggest TMEM18 might function as an ion channel or transporter, though this function awaits experimental confirmation.

What is the significance of TMEM18's interaction with nuclear pore proteins?

TMEM18's confirmed interactions with nuclear pore complex proteins (NDC1, AAAS, and NUP35/53) raise intriguing possibilities regarding its cellular functions:

  • Nuclear Transport Regulation: TMEM18 might modulate the transport of specific molecules between the nucleus and cytoplasm, potentially affecting gene expression.

  • Nuclear Membrane Organization: As a transmembrane protein interacting with nuclear pore components, TMEM18 could play a role in organizing nuclear membrane domains or anchoring nuclear pore complexes.

  • Signaling Integration: TMEM18 might serve as a link between metabolic signaling pathways and nuclear functions, potentially explaining its role in obesity.

These possibilities represent important directions for future research to elucidate TMEM18's precise cellular functions .

How might TMEM18 integrate with known hypothalamic appetite-regulating pathways?

Several observations suggest potential mechanisms of integration:

  • Leptin Responsiveness: TMEM18 expression in the PVN is regulated by leptin during fasting, suggesting it may be part of the leptin signaling pathway that controls energy balance .

  • Hypothalamic Localization: TMEM18 expression in multiple hypothalamic nuclei (arcuate, ventromedial, paraventricular, and dorsomedial) positions it to interact with established appetite-regulating circuits .

  • Temporal Pattern of Effects: AAV-mediated TMEM18 overexpression causes hypophagia at 2 weeks but increased energy expenditure at 6 weeks, suggesting it may interact with distinct regulatory pathways with different temporal dynamics .

Further research using techniques such as single-cell RNA sequencing of hypothalamic neurons and conditional knockout in specific neuronal populations could help elucidate TMEM18's integration with established appetite-regulating pathways.

What are potential pitfalls in interpreting TMEM18 knockout phenotypes?

Researchers should consider several factors when interpreting TMEM18 knockout results:

Sex Differences: Female TMEM18 homozygous knockout mice show no differences in body weight or body composition compared to wild-type littermates, while males show significant increases in body weight, fat mass, and lean mass . This sexual dimorphism necessitates analyzing both sexes separately.

Developmental Compensation: Germline knockouts may trigger compensatory mechanisms during development. The observation that acute overexpression in adults produces metabolic effects suggests these compensatory mechanisms may not fully restore function .

Gene Specificity: When using the tm1a(EUCOMM)Wtsi Tmem18 knockout allele, researchers should verify that neighboring genes are not affected. RNA-Seq analysis confirmed that TMEM18 was the only transcript at that locus altered by introduction of the allele, with no effects on neighboring genes (Sh3yl1, Snth2, and Acp1) .

What considerations are important when studying TMEM18 in different hypothalamic nuclei?

Regional Expression Patterns: TMEM18 is expressed in multiple hypothalamic nuclei, but its regulation and function may differ between regions. RNA-Seq analysis showed expression in arcuate, ventromedial, paraventricular, and dorsomedial nuclei .

Nutritional Responsiveness: While 48-hour fasting significantly decreased TMEM18 expression in the PVN, a separate RNA-Seq analysis found no significant changes after 24-hour fasting in any of four nuclei examined . This suggests that:

  • Longer fasting periods may be needed to observe changes

  • Different nuclei may respond differently to nutritional challenges

  • Sensitivity of detection methods may affect results

Targeting Precision: When using stereotactic injections for region-specific manipulations, validation of targeting accuracy is essential. Control experiments using AAV-GFP to confirm targeting precision should precede experimental manipulations .

What methods are recommended for analyzing energy expenditure data in TMEM18 studies?

When analyzing energy expenditure data from TMEM18 manipulation studies, researchers should consider:

Body Weight Confounding: Since TMEM18 manipulation affects body weight, and body weight influences energy expenditure, statistical approaches that account for this relationship are critical. Analysis of covariance (ANCOVA) with body weight as a covariate is recommended, as demonstrated in the analysis showing increased energy expenditure in TMEM18-overexpressing mice (P=0.03 after correction for body weight differences) .

Temporal Dynamics: The effects of TMEM18 manipulation on energy balance parameters may change over time. For example, AAV-mediated TMEM18 overexpression initially affected food intake (2 weeks post-surgery) but later affected energy expenditure (6 weeks post-surgery) . This suggests the importance of longitudinal measurements to capture the full spectrum of metabolic effects.

Comprehensive Phenotyping: Given TMEM18's complex effects on energy balance, comprehensive metabolic phenotyping including food intake, energy expenditure, locomotor activity, and body composition analysis is recommended for a complete understanding of its metabolic effects.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.