Recombinant Human Transmembrane protein 191A (TMEM191A)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline for your use.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us; we will prioritize its development.
Synonyms
TMEM191A; Transmembrane protein 191A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-160
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
TMEM191A
Target Protein Sequence
MMNNTDFLMLNNPWNKLCLVSMDFCFPLDFVSNLFWIFASKFIIVTGQIKADFKRTSWEA KAEGSLEPGRLKLQLASIVPLYSSLVTAGPASKIIILKRTSLPTVSPSNERAYLLPVSFT DLAHVFYLSYFSINAKSNSFSLDIIIALGIPHNTQAHFNH
Uniprot No.

Target Background

Database Links

HGNC: 25317

UniGene: Hs.546454

Protein Families
TMEM191 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What experimental approaches are recommended for confirming TMEM191A expression?

Methodological approach:
To confirm TMEM191A expression, researchers should implement a multi-platform verification strategy:

  • RT-PCR and qPCR: Design primers specific to TMEM191A transcripts, being careful to distinguish from closely related sequences

  • RNA-seq analysis: Examine transcriptome data for evidence of TMEM191A expression across different tissues

  • Western blotting: Use validated antibodies against TMEM191A, though availability may be limited due to its pseudogene status

  • Immunohistochemistry/Immunofluorescence: For tissue/cellular localization if expression is confirmed

When studying pseudogenes like TMEM191A, researchers should be particularly attentive to potential cross-reactivity with related family members. Unlike conventional protein-coding genes, pseudogene expression patterns often show tissue-specific or context-dependent variations that require careful experimental design and controls.

What are the structural characteristics of TMEM191A?

While detailed structural information for TMEM191A is limited, transmembrane proteins typically contain:

  • Transmembrane domains: Hydrophobic alpha-helical segments that span the lipid bilayer

  • Cytoplasmic domains: Regions facing the cell interior that may interact with signaling molecules

  • Extracellular domains: Portions exposed outside the cell that may participate in interactions with other proteins or ligands

Computational predictions of TMEM191A structure can be performed using algorithms like TMHMM and HMMTOP, although results may vary between different prediction tools, as observed with related transmembrane proteins . For more reliable structural insights, researchers might consider comparative modeling based on homologous proteins with resolved structures, recognizing the limitations of such approaches for pseudogenes.

How can researchers distinguish between TMEM191A and other structurally similar transmembrane proteins?

Methodological approach:

Distinguishing TMEM191A from other similar proteins requires a strategic combination of techniques:

  • Sequence alignment and phylogenetic analysis: Compare the TMEM191A sequence with related family members to identify unique regions

  • Domain-specific antibodies: Generate antibodies targeting unique epitopes of TMEM191A if they exist

  • CRISPR-Cas9 gene editing: Create knockout models to verify specificity of detection methods

  • Mass spectrometry: Perform proteomic analysis with high-resolution instruments to differentiate closely related proteins

  • Co-immunoprecipitation experiments: Identify specific protein-protein interactions characteristic of TMEM191A

When designing experiments, consider that transmembrane proteins like TMEM41B and VMP1 can form functional complexes as observed in autophagy regulation . Similar interactions might exist for TMEM191A if expressed, requiring careful experimental design to distinguish direct and indirect effects.

What are the optimal expression systems for producing recombinant TMEM191A for research purposes?

Methodological approach:

For effective expression of recombinant TMEM191A, researchers should consider:

Expression SystemAdvantagesLimitationsOptimization Strategies
Mammalian cells (HEK293, CHO)Native folding environment, proper PTMsLower yield, higher costCodon optimization, stable cell line generation
Insect cells (Sf9, High Five)High expression, proper foldingGlycosylation differencesBaculovirus optimization, expression temperature adjustment
E. coli systemsScalability, lower costInclusion body formationFusion tags (SUMO, MBP), solubility enhancers
Cell-free systemsRapid production, membrane mimeticsLimited scale, expensiveNanodiscs, detergent optimization

For transmembrane proteins, researchers have successfully employed sequential purification strategies using affinity tags (FLAG, His) followed by size-exclusion chromatography, as demonstrated with TMEM41B and VMP1 . Similar approaches could be applied to TMEM191A, with adaptations to address its specific characteristics.

What genomic technologies are most effective for studying pseudogenes like TMEM191A?

Advanced genomic approaches offer powerful tools for investigating pseudogenes:

  • Long-read sequencing technologies: Oxford Nanopore or PacBio sequencing can resolve complex genomic regions and structural variations affecting pseudogenes

  • Single-cell transcriptomics: Reveals potential cell-type specific expression patterns of TMEM191A transcripts

  • CRISPR screens: Genome-wide approaches can identify functional relationships and regulatory networks involving TMEM191A, similar to screens identifying novel autophagy genes like TMEM41B

  • Epigenomic profiling: Chromatin immunoprecipitation sequencing (ChIP-seq) and ATAC-seq can identify regulatory elements controlling TMEM191A expression

  • RNA-protein interaction studies: CLIP-seq techniques to determine if TMEM191A RNA interacts with RNA-binding proteins

Next-generation sequencing has revolutionized the study of genomics, enabling deeper understanding of genetic mechanisms and variations . These technologies are particularly valuable for studying pseudogenes, which were previously overlooked but now recognized for potential regulatory functions.

How can researchers investigate potential regulatory roles of TMEM191A as a pseudogene?

Methodological approach:

To explore regulatory functions of TMEM191A transcripts:

  • RNA interference approaches: Use siRNA or shRNA targeting TMEM191A transcripts to assess functional consequences

  • Overexpression studies: Express TMEM191A RNA in different cellular contexts to observe phenotypic changes

  • RNA-RNA interaction mapping: Identify potential interactions between TMEM191A transcripts and other RNAs using techniques like CLASH or RAP-RNA

  • Subcellular localization: Determine where TMEM191A transcripts are present within cells using RNA-FISH

  • Genomic regulatory analysis: Investigate whether TMEM191A locus contains enhancers or other regulatory elements affecting nearby genes

In genomic research, understanding RNA interactions and regulatory networks has revealed that non-coding elements, including pseudogenes, can have significant biological functions through mechanisms like microRNA sequestration or chromatin modification .

What are the appropriate cellular models for studying TMEM191A function?

When selecting cellular models, consider:

  • Tissue relevance: Choose cell types where TMEM191A is potentially expressed based on transcriptomic databases

  • Genetic background: Consider using cells with specific genetic backgrounds to study context-dependent functions

  • Differentiation models: Employ cellular differentiation systems to study potential developmental roles

  • Patient-derived cells: If TMEM191A is implicated in any condition, patient cells can provide valuable insights

  • 3D culture systems: Complex cellular models may better recapitulate physiological environments where TMEM191A functions

For transmembrane proteins involved in specialized cellular processes like autophagy (e.g., TMEM41B ), appropriate cellular models showing robust expression of the pathway components are essential for meaningful functional studies.

What protein-protein interaction methodologies are recommended for TMEM191A research?

Methodological approach:

For investigating potential protein interactions:

  • Co-immunoprecipitation: Use tagged versions of TMEM191A to identify interacting partners, as demonstrated with other transmembrane proteins like TMEM41B and VMP1

  • Proximity labeling: BioID or APEX2 approaches allow identification of proteins in close proximity to TMEM191A in living cells

  • Membrane-specific yeast two-hybrid: Modified Y2H systems designed for membrane proteins

  • FRET/BRET analysis: For studying dynamic interactions in live cells

  • Crosslinking mass spectrometry: To capture transient or weak interactions

When designing interaction studies, consider that transmembrane proteins often form functional complexes. For example, TMEM41B and VMP1 physically interact and function together in autophagosome formation . These approaches require careful controls, particularly for proteins with multiple transmembrane domains that can affect protein folding and accessibility.

What methodologies can assess TMEM191A involvement in disease mechanisms?

To investigate potential disease associations:

  • Genetic association studies: Analyze TMEM191A locus variations in disease cohorts

  • Transcriptome analysis: Compare TMEM191A expression between normal and disease tissues

  • Functional genomics: Use CRISPR screens to identify synthetic lethal interactions in disease models

  • Animal models: Generate conditional knockout models to assess physiological relevance

  • Patient-derived samples: Analyze expression patterns in relevant clinical specimens

Genomic research has transformed our understanding of disease mechanisms by identifying genetic markers associated with specific conditions, enabling more precise diagnostic approaches and targeted therapies . Similar approaches could reveal whether TMEM191A has undiscovered roles in health or disease.

How can researchers evaluate TMEM191A as a potential therapeutic target?

Methodological approach:

For therapeutic target assessment:

  • Target validation studies: Confirm disease relevance through genetic modulation in disease models

  • Druggability assessment: Evaluate presence of potential binding pockets or regulatory mechanisms

  • Small molecule screening: Develop assays to identify compounds affecting TMEM191A expression or function

  • Functional redundancy analysis: Determine if other proteins compensate for TMEM191A modulation

  • Off-target risk assessment: Evaluate sequence similarity with other genes to predict specificity challenges

Therapeutic approaches targeting transmembrane proteins have shown success in various disease contexts. For example, understanding the structural and functional properties of transmembrane proteins has enabled the development of targeted immunotherapies . Similar principles could be applied if TMEM191A demonstrates therapeutic relevance.

What are the most common technical challenges when working with recombinant transmembrane proteins like TMEM191A?

Researchers frequently encounter these challenges:

  • Low expression yields: Transmembrane proteins often express poorly in recombinant systems

  • Protein aggregation: Hydrophobic domains can cause aggregation during expression and purification

  • Functional reconstitution: Maintaining proper folding and activity outside native membrane environments

  • Structural analysis limitations: Transmembrane proteins are challenging for techniques like X-ray crystallography

  • Antibody specificity: Generating specific antibodies against transmembrane proteins is difficult due to limited exposed epitopes

Solution approaches:

  • Use specialized expression systems designed for membrane proteins

  • Optimize detergent screening for extraction and stabilization

  • Consider nanodiscs or liposomes for functional reconstitution

  • Employ cryo-EM for structural studies

  • Validate antibodies using knockout controls to ensure specificity

What bioinformatic resources and tools are most valuable for TMEM191A research?

Methodological resources:

Resource CategorySpecific ToolsApplication for TMEM191A Research
Sequence AnalysisBLAST, HMMER, Clustal OmegaIdentify homologs and conserved domains
Transmembrane PredictionTMHMM, HMMTOP, PhobiusPredict membrane topology and orientation
Structural PredictionAlphaFold, RoseTTAFold, I-TASSERGenerate structural models
Expression DatabasesGTEx, Human Protein AtlasAnalyze tissue expression patterns
Variant DatabasesgnomAD, ClinVarIdentify natural variations and potential disease associations
Functional NetworksSTRING, GeneMANIAPredict functional associations

Genomic research increasingly relies on sophisticated bioinformatic approaches to analyze complex datasets and identify patterns that may not be immediately apparent through experimental methods alone . These computational tools are particularly valuable for studying proteins with limited experimental characterization.

What emerging technologies might advance our understanding of TMEM191A?

Methodological frontiers:

  • Spatial transcriptomics: Map TMEM191A expression within tissue architecture with subcellular resolution

  • Deep mutational scanning: Systematically assess the impact of mutations across the TMEM191A sequence

  • AlphaFold and other AI-driven structure prediction: Generate increasingly accurate structural models

  • Single-molecule imaging: Visualize TMEM191A dynamics in living cells with advanced microscopy

  • Multiomics integration: Combine genomic, transcriptomic, proteomic, and metabolomic data for comprehensive understanding

The field of genomics continues to evolve rapidly with new technologies enabling increasingly sophisticated analyses of genetic elements previously considered non-functional . These approaches could reveal unexpected roles for pseudogenes like TMEM191A.

What are the key unanswered questions about TMEM191A that researchers should prioritize?

Priority research questions include:

  • Evolutionary conservation: Is TMEM191A conserved across species, and what does this suggest about its function?

  • Regulatory mechanisms: Does TMEM191A RNA participate in gene regulation despite its pseudogene classification?

  • Protein expression possibility: Under what conditions, if any, might TMEM191A produce protein products?

  • Tissue specificity: Are there tissues where TMEM191A shows particularly high expression or function?

  • Disease relevance: Are there genetic variations in TMEM191A associated with specific diseases or conditions?

Addressing these questions requires integrative approaches combining genomic technologies, functional assays, and computational analyses to build a comprehensive understanding of TMEM191A biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.