Recombinant Human Transmembrane protein 191C (TMEM191C)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment according to your needs.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline for customers.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag type, please inform us; we will prioritize development accordingly.
Synonyms
TMEM191C; Transmembrane protein 191C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-121
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
TMEM191C
Target Protein Sequence
MEAAEELDAWQSGRELCDGQLRGVQYSTESLMEEMARADRETRLFGGPRALAIRRCVLGA LQVLLTLPLLFLGLSLLWTVLLDPGAVSAWLWSLTSETTLRRLRYTLSPLLELRANGLLP T
Uniprot No.

Target Background

Database Links

HGNC: 33601

KEGG: hsa:645426

UniGene: Hs.376511

Protein Families
TMEM191 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is TMEM191C and what is its basic function?

TMEM191C (transmembrane protein 191C) is a protein-coding gene located on chromosome 22. It belongs to the transmembrane protein family, which typically spans the cell membrane and plays roles in cellular signaling, transport, and structural integrity. While the specific function of TMEM191C remains under investigation, genomic studies have identified it as potentially significant in adaptive responses to environmental stressors .

The protein contains characteristic transmembrane domains that anchor it within cellular membranes. Current research suggests it may play a role in cellular response mechanisms, potentially including responses to ionizing radiation or other extreme environmental conditions, as it has been identified in positive selection studies of populations exposed to such conditions .

What expression patterns does TMEM191C exhibit across different tissues?

TMEM191C expression varies across tissue types, with current research indicating differential expression patterns that may correlate with tissue-specific functions. When studying TMEM191C expression, researchers should consider:

  • Tissue-specific expression analysis using RT-qPCR

  • Comparative expression studies across developmental stages

  • Expression changes under various cellular stress conditions

  • Correlation of expression levels with tissue function

A methodological approach to studying TMEM191C expression involves tissue sampling from multiple organs, RNA extraction following standard protocols, cDNA synthesis, and quantitative PCR using TMEM191C-specific primers. Expression data should be normalized to established housekeeping genes appropriate for the tissues being studied.

What are the standard methods for producing recombinant TMEM191C protein?

Producing recombinant TMEM191C presents specific challenges due to its transmembrane nature. The following methodological approach is recommended:

  • Gene synthesis or PCR amplification of the TMEM191C coding sequence

  • Cloning into an appropriate expression vector with affinity tags (e.g., His-tag or FLAG-tag)

  • Expression in eukaryotic systems (preferred over bacterial systems due to the need for proper membrane insertion and post-translational modifications)

  • Extraction using specialized detergent-based protocols designed for membrane proteins

  • Purification via affinity chromatography with consideration for maintaining the native conformation

For functional studies, researchers should consider expression systems that closely mimic human cellular environments, such as HEK293 or CHO cells, with inducible promoters to control expression levels and minimize potential toxicity.

How has positive selection influenced TMEM191C genetic variation in human populations?

TMEM191C has been identified among genes showing signatures of positive selection in populations exposed to extreme environmental conditions, particularly in Lithuanian clean-up workers of the Chornobyl nuclear disaster (LCWC) . This finding suggests that genetic variants of TMEM191C may confer adaptive advantages in response to ionizing radiation or other stressors.

Research methodology for investigating positive selection signatures includes:

  • Whole-genome sequencing of populations with known exposure to selective pressures

  • Comparative analysis with control populations

  • Application of statistical methods such as RAiSD (μ statistic) to detect selective sweeps

  • Identification of specific variants within the TMEM191C genomic region

In the LCWC cohort, TMEM191C showed significant positive selection signatures (μ = 45.96) on chromosome 22 , suggesting that variants of this gene may contribute to adaptiveness and potentially to protective mechanisms against radiation damage.

What is known about TMEM191C genetic variants and their association with disease risk?

While comprehensive disease association studies specific to TMEM191C remain limited, its emergence in positive selection studies suggests potential significance for disease resistance or susceptibility. Investigating TMEM191C variants requires:

  • Genome-wide association studies (GWAS) in diverse populations

  • Case-control studies for specific diseases, particularly those related to environmental exposures

  • Functional characterization of identified variants

  • Correlation with clinical outcomes

The identification of TMEM191C in positive selection studies of individuals who survived extreme radiation exposure suggests potential protective effects against radiation-induced pathologies . Researchers investigating disease associations should consider:

  • Sequencing TMEM191C in cohorts with varying disease susceptibility

  • Functional studies of variant effects on protein structure and activity

  • Cell-based assays to assess variant impact on cellular responses to stressors

  • Population stratification to identify environment-specific protective effects

What gene-chemical interactions have been observed with TMEM191C and how might these influence its function?

Gene-chemical interaction studies have revealed that TMEM191C responds to environmental chemicals, potentially influencing its expression and methylation patterns. Specifically:

  • 1,2-dichloroethane (ethylene dichloride) exposure increases TMEM191C expression

  • 4,4'-sulfonyldiphenol (bisphenol S) exposure decreases methylation of TMEM191C exons

These interactions suggest that TMEM191C function may be modulated by environmental exposures, with potential implications for cellular response mechanisms. Methodological approaches to study these interactions include:

  • Cell culture exposure models with controlled chemical concentrations

  • Expression analysis using RT-qPCR before and after chemical exposure

  • Methylation analysis using bisulfite sequencing

  • Functional assays to assess cellular phenotypes associated with altered TMEM191C expression

The observation that environmental chemicals can alter TMEM191C expression and methylation suggests it may function within cellular response pathways to xenobiotics or environmental stressors.

What are the key considerations for designing experiments to study TMEM191C function?

Designing rigorous experiments to study TMEM191C requires careful consideration of variables and appropriate controls. Following established experimental design principles , researchers should:

  • Clearly define independent variables (e.g., TMEM191C expression levels, variants being tested, environmental exposures) and dependent variables (e.g., cellular phenotypes, protein interactions, signaling responses)

  • Control for confounding variables such as cell type, culture conditions, and expression of related proteins

  • Include appropriate positive and negative controls for each experimental condition

  • Ensure statistical power through adequate sample sizes and replication

When designing knockdown or overexpression studies, consider:

  • siRNA/shRNA approaches for temporary knockdown

  • CRISPR-Cas9 for permanent gene editing

  • Inducible expression systems to control timing and level of expression

  • Rescue experiments to confirm specificity of observed phenotypes

Due to its transmembrane nature, subcellular localization studies should employ:

  • Fluorescent protein tags positioned to minimize interference with protein topology

  • Co-localization studies with established membrane compartment markers

  • Live-cell imaging to observe dynamics of protein trafficking

What cellular and molecular phenotypes should be assessed when studying TMEM191C function?

Based on available data suggesting TMEM191C's role in adaptive responses and its positive selection in radiation-exposed populations , researchers should consider assessing:

  • Cellular stress responses, particularly to radiation and chemical stressors

    • Cell viability assays following exposure to ionizing radiation

    • DNA damage response assessment (γ-H2AX foci, comet assay)

    • Apoptosis markers (Annexin V staining, caspase activation)

  • Membrane integrity and function

    • Membrane permeability assessments

    • Lipid raft association studies

    • Ion flux measurements if channel activity is suspected

  • Signaling pathway activation

    • Phosphoproteomic analysis before and after stress exposure

    • Reporter assays for stress-responsive transcription factors

    • Protein-protein interaction studies to identify binding partners

  • Transcriptional responses

    • RNA-Seq to identify genes co-regulated with TMEM191C

    • ChIP-Seq if transcriptional regulatory functions are suspected

    • Response element reporter assays

A comprehensive functional assessment should systematically evaluate these phenotypes in both normal and TMEM191C-modified cellular models under various stress conditions.

How can researchers effectively model the impact of TMEM191C variants identified in populations under selective pressure?

To model the impact of TMEM191C variants identified in populations under selective pressure, such as the LCWC cohort , researchers should employ a multi-faceted approach:

  • Genomic characterization:

    • Deep sequencing of the TMEM191C locus in target populations

    • Identification of specific variants showing selection signatures

    • Comparison with reference populations to confirm uniqueness

  • Variant modeling in cellular systems:

    • CRISPR-Cas9 knock-in of specific variants

    • Isogenic cell line creation differing only in TMEM191C variants

    • Inducible expression systems for temporal control

  • Functional assessment methodology:

    • Exposure to simulated environmental stressors (radiation, chemicals)

    • Measurement of cellular survival and adaptation metrics

    • Molecular phenotyping (transcriptomics, proteomics, metabolomics)

    • Comparative analysis between variant and wild-type responses

  • Population-level validation:

    • Genotype-phenotype correlation studies in original populations

    • Extension to other populations with similar selective pressures

    • Meta-analysis to strengthen statistical power

This methodological framework allows researchers to establish causality between specific TMEM191C variants and adaptive phenotypes observed in populations under selective pressure.

What statistical approaches are most appropriate for analyzing genomic data related to TMEM191C positive selection?

When analyzing genomic data for positive selection signatures in TMEM191C, researchers should consider multiple complementary statistical approaches:

  • Selective sweep detection:

    • RAiSD μ statistic for identifying regions under recent positive selection

    • Extended haplotype homozygosity (EHH) and integrated haplotype score (iHS)

    • Cross-population extended haplotype homozygosity (XP-EHH)

    • Tajima's D to assess allele frequency distribution patterns

  • Comparative genomics:

    • FST analysis to quantify population differentiation

    • dN/dS ratio to assess functional constraint

    • Phylogenetic analysis to determine evolutionary conservation

  • Data representation:

    • Manhattan plots highlighting regions of significant selection

    • Haplotype visualization tools for population comparisons

    • Principal component analysis for population stratification

For the specific case of TMEM191C in the LCWC cohort, the RAiSD μ value of 45.96 indicates significant positive selection. This should be contextualized with:

  • Comparison to background selection rates in the genome

  • Analysis of surrounding genes for hitchhiking effects

  • Assessment of linkage disequilibrium patterns

Statistical significance should be established through appropriate multiple testing correction methods, such as Bonferroni or false discovery rate (FDR) approaches.

How should researchers interpret TMEM191C gene-chemical interaction data in the context of environmental exposures?

Interpreting gene-chemical interaction data for TMEM191C requires careful consideration of biological context and experimental limitations. Based on observed interactions with chemicals like 1,2-dichloroethane and 4,4'-sulfonyldiphenol , researchers should:

  • Establish dose-response relationships:

    • Determine threshold concentrations for observed effects

    • Characterize temporal dynamics of responses

    • Assess reversibility of changes after exposure cessation

  • Contextualize with physiologically relevant exposures:

    • Compare experimental concentrations with environmental levels

    • Consider tissue-specific bioaccumulation potential

    • Evaluate chronic vs. acute exposure differences

  • Integrate with functional outcomes:

    • Correlate expression or methylation changes with cellular phenotypes

    • Assess downstream pathway activation

    • Determine impact on cellular fitness under stress conditions

  • Consider epigenetic persistence:

    • Evaluate stability of methylation changes

    • Assess potential for transgenerational effects

    • Investigate chromatin restructuring associated with expression changes

When interpreting the finding that 1,2-dichloroethane increases TMEM191C expression , researchers should consider:

  • Potential adaptive response mechanisms

  • Cellular protective pathways that might be activated

  • Long-term consequences of sustained expression changes

The observed decrease in TMEM191C exon methylation by bisphenol S should be analyzed for:

  • Impact on splicing patterns

  • Correlation with expression changes

  • Tissue-specific effects based on exposure patterns

What are the most promising research applications for TMEM191C given its positive selection in populations exposed to extreme conditions?

The identification of TMEM191C among genes under positive selection in populations exposed to extreme conditions, particularly ionizing radiation , opens several promising research avenues:

  • Radiation protection applications:

    • Characterization of protective mechanisms conferred by specific TMEM191C variants

    • Development of biomarkers for radiation sensitivity

    • Potential therapeutic targets for radiation protection

  • Stress response modulation:

    • Elucidation of TMEM191C's role in cellular stress response pathways

    • Identification of small molecules that can mimic protective TMEM191C functions

    • Application to conditions involving oxidative stress or DNA damage

  • Evolutionary adaptation research:

    • Comparative analysis across populations with different environmental pressures

    • Investigation of how recent human activities have shaped selection on this gene

    • Insights into human adaptive capacity to anthropogenic stressors

  • Personalized medicine applications:

    • Genotype-based risk assessment for environments with radiation exposure

    • Tailored protective measures based on TMEM191C variants

    • Potential gene therapy approaches targeting TMEM191C pathways

Each of these directions requires methodological approaches spanning genomics, molecular biology, and clinical research, with a focus on translating basic insights into practical applications.

What is the potential significance of TMEM191C in understanding human adaptiveness to extreme environments?

The positive selection of TMEM191C in the LCWC cohort provides a unique window into human adaptation to extreme environments. Its research significance includes:

  • Mechanism elucidation:

    • Understanding molecular pathways that enable survival in harsh conditions

    • Identifying cellular processes that can be enhanced for protection

    • Distinguishing innate versus acquired adaptive responses

  • Evolutionary insights:

    • Characterizing recent human evolution in response to technological hazards

    • Comparing with historical selective pressures on this locus

    • Understanding the speed and extent of adaptation to novel threats

  • Population health implications:

    • Identifying genetic factors that confer resilience to environmental stressors

    • Developing targeted interventions for vulnerable populations

    • Informing public health responses to environmental disasters

  • Bioethical considerations:

    • Understanding genetic determinants of differential vulnerability

    • Addressing equity concerns in environmental protection

    • Informing policy on hazardous environment exposures

Methodologically, researchers should approach this question through:

  • Multi-generational studies of exposed populations

  • Functional characterization of adaptive variants

  • Comparative analysis across multiple environmental stressors

  • Integration of genomic data with health outcomes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.