Recombinant Human Transmembrane protein 192 (TMEM192)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Human Transmembrane Protein 192 (TMEM192) is a lysosomal membrane protein with critical roles in cellular homeostasis, autophagy, and apoptosis. First identified through proteomic analyses of lysosomal membranes, TMEM192 has gained attention for its tissue-specific expression, structural uniqueness, and functional involvement in cancer biology. This article synthesizes key structural, functional, and research findings about TMEM192, emphasizing its recombinant applications and therapeutic relevance.

Structure and Biochemical Properties

TMEM192 is characterized by:

  • Four transmembrane segments with cytosolic N- and C-terminal domains .

  • Homodimer formation via interchain disulfide bonds, confirmed by co-immunoprecipitation and Western blotting under non-reducing conditions .

  • Lysosomal localization, colocalizing with markers like LAMP1 and lysosomal tracker LTR .

  • Tissue-specific proteolytic processing, generating a 17 kDa fragment in most murine tissues except the liver .

PropertyDetailSource
Molecular Weight~31 kDa (monomer), ~62 kDa (homodimer)
Post-Translational ModsNo N-glycosylation; pH-dependent proteolytic processing in lysosomes
Subcellular LocalizationLysosomal/late endosomal membranes

Tissue and Cellular Expression

TMEM192 exhibits distinct expression patterns:

Tissue Distribution

TissueExpression LevelNotesSource
LiverHighKey organ for TMEM192 mRNA abundance
KidneyHighStrong mRNA and protein expression
LungModerateDetected in proteomic analyses
PancreasModerateWidespread tissue distribution
Brain (Hippocampus)PronouncedMurine studies show regional specificity

Cellular Expression

Cell TypeTMEM192 ExpressionNotesSource
Tumor Cell Lines (e.g., HepG2, HeLa)HighOverexpression linked to autophagy control
Normal Cell Lines (e.g., LO2)LowMinimal detection in non-tumor cells

Functional Roles

TMEM192 regulates autophagy and apoptosis, with implications in cancer biology:

Autophagy Regulation

  • Lysophagy: TMEM192-mKeima probes demonstrated its role in lysosomal damage-induced autophagy (lysophagy), distinct from other lysosomal repair pathways .

  • Autophagy-Linked Apoptosis: TMEM192 knockdown in HepG2 cells activates:

    • LC3-II accumulation (autophagosome formation) .

    • Bax upregulation and caspase-3 activation, driving mitochondrial apoptosis .

    • ER stress via caspase-12 activation, amplifying apoptotic signals .

Cancer-Specific Pathways

PathwayTMEM192 RoleSource
Mitochondrial ApoptosisBax translocation → cytochrome c release → caspase-3 activation
ER Stress ApoptosisCaspase-12 cleavage → p38 MAPK phosphorylation → apoptotic signaling
Autophagy FluxLC3-II accumulation suppressed by Atg7 knockdown → apoptosis inhibition

In Vitro Studies

Study FocusKey FindingsSource
HepG2 KnockdownTMEM192 siRNA induces growth inhibition, autophagy, and apoptosis; Atg7 silencing blocks apoptosis.
Lysophagy MechanismTMEM192-mKeima probe identifies UBE2L3/UBE2N (E2 ubiquitin ligases) and TRIM10/16/27 as regulators.
Proteolytic ProcessingMurine TMEM192 undergoes pH-dependent cleavage post-lysosomal targeting.

In Vivo Studies

ModelFindingsSource
TMEM192-/- MiceNo lysosomal dysfunction under basal conditions; compensatory mechanisms observed.
Embryonic FibroblastsNormal autophagy and lysosomal exocytosis despite TMEM192 deficiency.

Research Tools and Antibodies

Tool/ReagentApplicationPerformance DataSource
TMEM192-mKeimaLysophagy-specific assayDistinguishes lysophagy from ESCRT/TFEB pathways
ab236858 (Abcam)WB, IP, IHCPredicted 31 kDa band; IHC validated in adrenal/glioma tissue
HPA014717 (Sigma)WB, IHCHomodimer detection; tissue expression profiling

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please specify it in your order notes. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery times, please contact your local distributor.
Note: All protein shipments are standardly packed with blue ice packs. If you require dry ice shipping, please communicate this in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Synonyms
TMEM192; Transmembrane protein 192
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-271
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
TMEM192
Target Protein Sequence
MAAGGRMEDGSLDITQSIEDDPLLDAQLLPHHSLQAHFRPRFHPLPTVIIVNLLWFIHLV FVVLAFLTGVLCSYPNPNEDKCPGNYTNPLKVQTVIILGKVILWILHLLLECYIQYHHSK IRNRGYNLIYRSTRHLKRLALMIQSSGNTVLLLILCMQHSFPEPGRLYLDLILAILALEL ICSLICLLIYTVKIRRFNKAKPEPDILEEEKIYAYPSNITSETGFRTISSLEEIVEKQGD TIEYLKRHNALLSKRLLALTSSDLGCQPSRT
Uniprot No.

Target Background

Gene References Into Functions
  1. Research has shown that transmembrane protein 192 (TMEM192) interacts with TIG1. Studies have also demonstrated that both TIG1A and TIG1B isoforms interact and co-localize with TMEM192 in HtTA cervical cancer cells. The expression of TIG1 has been observed to induce the expression of autophagy-related proteins. PMID: 27989102
  2. TMEM192 deficiency has been linked to the induction of autophagy in tumor cells, which can further activate apoptosis via the mitochondrial pathway. PMID: 22736246
  3. TMEM192 has been found to be highly expressed in human kidney, liver, lung, and pancreas tissues. This widespread tissue distribution suggests a potential crucial role for TMEM192 in lysosomal function. PMID: 20370317
Database Links

HGNC: 26775

KEGG: hsa:201931

STRING: 9606.ENSP00000305069

UniGene: Hs.704511

Protein Families
TMEM192 family
Subcellular Location
Lysosome membrane; Multi-pass membrane protein. Late endosome.
Tissue Specificity
Strongly expressed in kidney, liver, lung and pancreas.

Q&A

What is the basic structure of human TMEM192?

TMEM192 is a 271-residue lysosomal/late endosomal protein with four transmembrane segments. Both N- and C-termini face the cytosol, as confirmed by immunogold labeling and proteinase protection assays . The protein forms homodimers linked by disulfide bridges, specifically through Cys266 in the C-terminal region . This is particularly interesting as this cysteine would be predicted to localize in the reductive environment of the cytosol, where disulfide bridges are generally uncommon .

How is TMEM192 targeted to lysosomes?

Lysosomal targeting of TMEM192 is mediated by two directly adjacent N-terminally located dileucine motifs of the DXXLL-type . Experimental evidence using CD4 chimeric constructs and targeted mutagenesis has shown that disruption of both dileucine motifs results in mistargeting of TMEM192 to the plasma membrane, while each individual motif is sufficient to ensure correct targeting to late endosomes/lysosomes .

What is the expression pattern of TMEM192 across tissues?

TMEM192 exhibits ubiquitous tissue expression with varying levels:

TissueRelative Expression Level
Bone marrowHigh
ThymusHigh
SpleenHigh
KidneyHigh
BrainHigh (particularly in hippocampus)
Spinal cordModerate
LiverLow
LungLow
Sciatic nerveLow

Source: Based on Western blot analysis of murine tissues .

What antibodies are available for studying TMEM192?

Multiple antibodies have been developed for TMEM192 research, including:

  • Rabbit monoclonal antibodies TMEM192AB1 (recognizing C-terminal residues 235-250) and TMEM192AB2 (recognizing residues 200-235)

  • Rabbit polyclonal antibodies suitable for immunoprecipitation (IP), Western blotting (WB), immunohistochemistry (IHC-P), and immunofluorescence (ICC/IF)

  • Species-specific antibodies with varying epitopes (e.g., antibodies against N-terminal epitopes of murine TMEM192)

When selecting antibodies, researchers should consider both the species of interest and the specific epitope, especially when working with truncated forms or processed fragments of TMEM192.

How can lysosomal isolation techniques utilizing TMEM192 be implemented?

Two primary methodologies have been developed:

  • LysoTag Method:

    • Requires exogenous expression of TMEM192 with epitope tags (typically three tandem HA epitopes at C-terminus)

    • Applicable to cell culture models and genetically modified mice

    • Allows rapid immunoprecipitation of lysosomes using anti-HA antibodies

  • Tagless LysoIP Method:

    • Utilizes antibodies against endogenous TMEM192

    • Applicable to clinical samples and human-derived cells without genetic modification

    • Protocol involves:
      a) Homogenization in isotonic buffer using a ball bearing homogenizer
      b) Incubation with anti-TMEM192 antibodies coupled to magnetic beads
      c) Isolation of intact lysosomes suitable for multiple downstream analyses

This approach enables multimodal omics analyses of lysosomal content from clinical samples, particularly valuable for lysosomal storage disease research.

What role does TMEM192 play in autophagy regulation?

Research findings on TMEM192's role in autophagy reveal context-dependent effects:

  • In tumor cells (HepG2 hepatoma):

    • TMEM192 knockdown activates autophagy, as evidenced by increased LC3-II expression

    • This is linked to growth inhibition and increased apoptosis via the mitochondrial pathway

    • Blocking the expression of key autophagy gene Atg7 inhibits the increased apoptosis in TMEM192-deficient cells

  • In TMEM192-/- MEFs:

    • Normal LC3-II/I ratios and no accumulation of p62 under basal conditions

    • Comparable autophagic flux during starvation or Bafilomycin treatment to wild-type cells

    • Unaffected fusion of autophagosomes and lysosomes

    • Normal mTORC1 activity regulation (monitored through S6K phosphorylation)

These contrasting observations suggest cell type-specific or context-dependent functions of TMEM192 in autophagy regulation.

How does TMEM192 deficiency affect tumor cell growth?

TMEM192 appears to be important for tumor cell growth and proliferation. Studies have shown:

  • TMEM192 is highly expressed in tumor cell lines compared to normal cell lines

  • Knockdown of TMEM192 using siRNAs in HepG2 hepatoma cells results in:

    • Growth inhibition

    • Increased apoptosis

    • Activation of autophagy (detected through LC3-II expression)

The mechanism involves a crosstalk between autophagy and apoptosis, where TMEM192 deficiency triggers autophagy, which subsequently activates apoptosis through the mitochondrial pathway . This suggests that targeting TMEM192 could potentially be explored as a therapeutic approach for certain cancers.

How can TMEM192 be used in lysosomal storage disorder research?

The tagless LysoIP method utilizing TMEM192 has been validated for lysosomal disease research:

  • Successfully applied to isolate lysosomes from peripheral blood mononuclear cells (PBMCs) of CLN3 disease patients

  • Metabolic profiling of isolated lysosomes revealed massive accumulation of glycerophosphodiesters (GPDs) in patients' lysosomes

  • The method allows for biomarker discovery and disease monitoring in human lysosomal storage disorders

This approach overcomes previous limitations in studying lysosomal content directly from patient samples, enabling both biomarker discovery and deeper understanding of disease pathology.

What are the apparent contradictions in TMEM192 research that require further investigation?

Several notable contradictions in current research findings warrant further investigation:

These contradictions suggest potential compensatory mechanisms in vivo, cell type-specific functions, or context-dependent roles that require further elucidation through targeted experimental approaches.

What methodological considerations are important when studying TMEM192 proteolytic processing?

TMEM192 processing occurs after lysosomal targeting by pH-dependent lysosomal proteases. When investigating this process:

  • Disruption of lysosomal acidification (using Bafilomycin A1 or NH4Cl) prevents generation of the N-terminal fragment

  • Standard protease inhibitors targeting serine, cysteine, aspartyl, and metalloproteases do not completely prevent fragment generation

  • Processed fragments should be analyzed under non-reducing and reducing conditions to assess disulfide linkage status

  • Tissue-specific differences in processing efficiency should be considered when comparing results across different experimental systems

What are promising avenues for future TMEM192 research?

Based on current knowledge gaps, these research directions appear most promising:

  • Molecular Function Determination:

    • Identification of TMEM192 binding partners through proximity labeling approaches

    • Investigation of potential ion or metabolite transport functions

    • Structural studies to understand the dimerization interface and functional domains

  • Cancer Biology Applications:

    • Exploration of TMEM192 as a therapeutic target in cancer

    • Investigation of its differential expression across cancer types

    • Determination of mechanisms underlying its role in tumor cell survival

  • Lysosomal Biology:

    • Further development of TMEM192-based methods for studying lysosomal content in health and disease

    • Investigation of its potential role in lysosomal nutrient sensing or membrane dynamics

    • Elucidation of compensatory mechanisms in TMEM192-deficient systems

What technical challenges should researchers anticipate when working with TMEM192?

Researchers should be prepared to address several technical challenges:

  • Species-specific antibody recognition, requiring careful validation when switching between model systems

  • Potential artifacts from overexpression systems, necessitating comparison with endogenous protein behavior

  • Tissue-specific processing patterns that may complicate interpretation of experimental results

  • Context-dependent functional effects that vary between cell types and physiological conditions

  • Need for appropriate controls when using TMEM192 for lysosomal isolation to avoid isolation artifacts

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.