Recombinant Human Transmembrane protein 199 (TMEM199)

Shipped with Ice Packs
In Stock

Description

Introduction

Transmembrane protein 199 (TMEM199) is a protein encoded by the TMEM199 gene, found on chromosome 17 (chr17:26,684,687–26,689,089) . It is involved in maintaining the normal function of the Golgi apparatus and is associated with a specific type of congenital disorder of glycosylation (CDG) . CDG is a group of inherited metabolic disorders that affect how the body attaches sugar molecules (glycans) to proteins and lipids, which is critical for the structure and function of cells .

Gene and Protein Structure

The TMEM199 gene contains six exons and codes for a 208 amino acid protein . The protein includes a conserved Vma12 domain at its carboxyl (C) terminus, which is common among eukaryotes, including Arabidopsis thaliana . This domain contains two transmembrane helices . Research indicates that the N-terminus of TMEM199 is highly conserved in higher eukaryotes and that mutations in this region can lead to disease .

Function and Cellular Localization

TMEM199 plays a crucial role in Golgi homeostasis and the regulation of cellular iron levels . It is also an assembly factor for the vacuolar-ATPase complex, which controls HIF1α prolyl hydroxylation . Studies suggest TMEM199 is primarily localized in the Golgi complex and is essential for its normal structure and function .

4.1. TMEM199-CDG

Deficiency in TMEM199 leads to a specific congenital disorder of glycosylation (TMEM199-CDG), an autosomal recessive inherited disease . TMEM199-CDG is characterized by elevated serum transaminase levels, reduced serum ceruloplasmin, and steatosis .

4.2. Clinical Presentation of TMEM199-CDG

Patients with TMEM199-CDG typically exhibit a range of symptoms, including:

  • Elevated liver enzymes: High fluctuating levels of alanine aminotransferase (ALT), aspartate aminotransferase (AST), and alkaline phosphatase (ALP) .

  • Cholesterol abnormalities: Elevated total cholesterol and low-density lipoprotein cholesterol (LDL-C) levels .

  • Reduced ceruloplasmin and copper: Low levels of serum ceruloplasmin and serum copper .

  • Liver abnormalities: Liver biopsy showing lipid degeneration, mild steatosis, and minimal fibrosis .

  • Neurological issues: Some patients may experience intellectual disability, mild language retardation, and hypotonia .

4.3. Genetic Variants

Two pathogenic variants of the TMEM199 gene have been identified with the transcript of NM_152464.1 . These variants have been validated using Sanger sequencing .

TMEM199 and Platinum Drug Resistance

While most research focuses on TMEM199's role in Golgi function and CDG, other studies investigate different transmembrane proteins in the context of drug resistance in cancer. For example, TMEM205 is overexpressed in cancer cells resistant to cisplatin, a platinum-based chemotherapy drug . TMEM205 mediates the extrusion of cisplatin and oxaliplatin, but not carboplatin, leading to drug resistance .

TMEM88 as Therapeutic Target in Malignant Tumors

TMEM88, another transmembrane protein, has been identified as a potential therapeutic target in various cancers . It is involved in cell proliferation, differentiation, apoptosis, and tumor progression .

TMEM199 Expression

SystemExpression Level
Alimentary part of gastrointestinal system9
Appendage11
Circulatory system49
Ectoderm113
Endocrine system91
Endoderm90
Exocrine system59
Hemolymphoid system25
Hepatobiliary system59
Integumental system6
Mesenchyme218
Mesoderm97
Nervous system93
Renal system45
Reproductive system60
Respiratory system31

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
TMEM199; C17orf32; Transmembrane protein 199
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-208
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
TMEM199
Target Protein Sequence
MASSLLAGERLVRALGPGGELEPERLPRKLRAELEAALGKKHKGGDSSSGPQRLVSFRLI RDLHQHLRERDSKLYLHELLEGSEIYLPEVVKPPRNPELVARLEKIKIQLANEEYKRITR NVTCQDTRHGGTLSDLGKQVRSLKALVITIFNFIVTVVAAFVCTYLGSQYIFTEMASRVL AALIVASVVGLAELYVMVRAMEGELGEL
Uniprot No.

Target Background

Function
TMEM199 is an accessory component of the vacuolar (V)-ATPase proton pump, crucial for intracellular iron homeostasis. Under aerobic conditions, it regulates iron homeostasis by modulating Fe(2+) prolyl hydroxylase (PHD) enzyme activity, leading to HIF1A hydroxylation and subsequent proteasomal degradation. It is also essential for endolysosomal acidification and lysosomal degradation and may play a role in Golgi homeostasis.
Gene References Into Functions
  1. TMEM199's involvement in Golgi homeostasis and the hepatic phenotype with abnormal glycosylation resulting from TMEM199 deficiency have been identified. PMID: 26833330
Database Links

HGNC: 18085

OMIM: 616815

KEGG: hsa:147007

STRING: 9606.ENSP00000292114

UniGene: Hs.594696

Involvement In Disease
Congenital disorder of glycosylation 2P (CDG2P)
Subcellular Location
Cytoplasmic vesicle, COPI-coated vesicle membrane; Multi-pass membrane protein. Endoplasmic reticulum-Golgi intermediate compartment membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is TMEM199 and what are its primary cellular functions?

TMEM199, also known as C17orf32, is a transmembrane protein that functions as an accessory component of the proton-transporting vacuolar (V)-ATPase protein pump, which is critical for endolysosomal acidification. It is involved in activating Fe2+ prolyl hydroxylase (PHD) enzymes to maintain intracellular iron homeostasis . TMEM199 also plays a significant role in Golgi homeostasis, as its deficiency results in abnormal glycosylation patterns observed in hepatic phenotypes .

Recent research has uncovered that TMEM199 has nuclear localization and functions as a transcriptional co-factor, regulating the expression of immune checkpoint proteins like PD-L1 (CD274) . This dual localization (ER/Golgi and nuclear) suggests TMEM199 has more complex cellular functions than previously understood, particularly in immune regulation and cancer development.

How does TMEM199 deficiency affect cellular functions?

TMEM199 deficiency significantly impacts multiple cellular processes. At the subcellular level, TMEM199 knockdown results in decreased lysosome quantity, which impairs protein degradation pathways . This explains why TMEM199 knockdown can paradoxically increase levels of proteins like PD-L1, EGFR, and HLA under translation inhibition conditions, as these proteins are normally degraded through lysosomal pathways .

At the clinical level, TMEM199 mutations are associated with a rare genetic metabolic disease called congenital disorder of glycosylation (CDG), which manifests as developmental delays, muscular hypotonus, nervous system disease, hepatopathy, and blood coagulation dysfunction . TMEM199 deficiency is also linked to fatty liver disease caused by impaired lysosomal function, characterized by reduced acidification, impaired autophagy, and increased lysosomal lipid accumulation .

What experimental models are recommended for studying TMEM199?

Based on published research methodologies, several experimental models have proven effective for studying TMEM199:

  • Cell line models: HEK293T, 143B, and CAOV3 cell lines have been successfully used for TMEM199 studies . These cells can be maintained in DMEM supplemented with 10% FBS and antibiotics.

  • Genetic modification approaches:

    • TMEM199 overexpression using plasmids with Flag or eGFP tags

    • TMEM199 knockdown using lentiviral delivery of targeted siRNAs

    • Truncated TMEM199 constructs for domain-function analysis

  • Animal models: Xenograft models with TMEM199-knockdown cancer cells in mice have been used to evaluate in vivo effects on tumor growth and immune cell infiltration .

  • Molecular technique combinations: Immunofluorescence, western blotting, RNA sequencing, and Cut&Tag assays are particularly valuable for characterizing TMEM199 localization and function .

How does nuclear TMEM199 regulate CD274 (PD-L1) expression?

Nuclear TMEM199 regulates PD-L1 expression through a complex transcriptional mechanism. Cut&Tag assay results reveal that TMEM199 binds to the gene promoter sites of several transcription factors and cofactors that regulate PD-L1, including IFNGR1, IRF1, MTMR9, KAT8, and Trim28 . Through these interactions, TMEM199 modulates the mRNA expression levels of CD274 (the gene encoding PD-L1).

The regulatory mechanism has been experimentally verified through knockdown studies. When TMEM199 is knocked down, a significant decrease in CD274 mRNA expression is observed. Conversely, overexpressing Flag-tagged TMEM199 reverses this effect . Additional knockdown experiments of the transcription factors IFNGR1, IRF1, c-Jun, KAT8, and Trim28 in cells with uniform TMEM199 expression backgrounds showed decreased CD274 mRNA levels, confirming that these factors work in concert with TMEM199 to regulate PD-L1 expression .

Importantly, this transcriptional regulation is distinct from TMEM199's effect on protein degradation through lysosomal pathways, as direct interaction between TMEM199 and PD-L1 proteins has been excluded experimentally .

What are the methodological approaches for detecting nuclear localization of TMEM199?

Detecting the nuclear localization of TMEM199 requires specialized methodological approaches that go beyond conventional subcellular localization studies. The following methods have proven effective:

  • Immunofluorescence with specific fixation protocols: Cells should be grown on coverslips, fixed with 3.5% paraformaldehyde, and permeabilized with PBS containing 10% goat serum and 0.3% Triton X-100 . Treatment with 3% H₂O₂ for 10 minutes before antibody incubation helps reduce background. Anti-TMEM199 antibody (1:50 dilution) or anti-Flag antibody (1:100 dilution) for tagged constructs can be used, followed by fluorescent secondary antibodies and DAPI counterstaining .

  • Subcellular fractionation and western blotting: Nuclear and cytoplasmic fractions should be separated using established protocols, followed by western blot analysis using TMEM199-specific antibodies. Proper controls for nuclear (e.g., histone proteins) and cytoplasmic fractions are essential to validate the fractionation quality .

  • Cut&Tag assay: This method has been successfully employed to globally explore nuclear TMEM199 functions and identify its genomic binding sites . The technique involves tagging the chromatin-associated protein with an antibody, followed by protein A-Tn5 transposase fusion protein binding and DNA fragmentation at binding sites.

  • Truncation analysis: Generating truncated TMEM199 constructs has helped identify specific domains responsible for nuclear localization . This approach can determine which domains are necessary and sufficient for proper nuclear targeting.

How does TMEM199 impact tumor microenvironment and immune responses?

TMEM199's impact on the tumor microenvironment represents a significant finding with implications for cancer immunotherapy. While TMEM199 knockdown or overexpression does not directly affect cancer cell proliferation or invasion in vitro, it significantly influences tumor growth in vivo through immune microenvironment modulation .

In xenograft models, tumors with TMEM199 knockdown showed significantly reduced sizes compared to control tumors . Analysis of immune cell infiltration revealed increased proportions of CD8+ (cytotoxic T cells) and CD11b+ cells, with decreased CD4+ cells in TMEM199-knockdown xenografts . This altered immune cell profile likely contributes to enhanced anti-tumor immunity.

RNA sequencing analysis of differentially expressed genes between control and TMEM199 knockdown cells showed enrichment in immune response and tumor necrosis factor-mediated signaling pathway gene ontology terms . This further supports TMEM199's role in modulating immune responses within the tumor microenvironment.

The mechanism connecting TMEM199 to immune regulation involves its control of PD-L1 expression. By regulating PD-L1 through transcriptional mechanisms, TMEM199 influences how cancer cells interact with immune cells, particularly T lymphocytes expressing PD-1 . This PD-L1/PD-1 interaction is crucial for cancer immune evasion, as it induces tumor-infiltrating T cell apoptosis and restrains T cell activation, proliferation, survival, and effector functions .

What is the relationship between TMEM199 and V-ATPase assembly?

TMEM199 is described as a human homolog of yeast V-ATPase assembly factor Vph2p (also known as Vma12p) . The V-ATPase complex is a critical proton pump responsible for endolysosomal acidification. In yeast, V-ATPase assembly factors Vph2p, Vma21p, Pkr1p, and Vma22p localize to the endoplasmic reticulum (ER) .

The recent discovery of TMEM199's nuclear localization adds another layer of complexity to understanding its relationship with V-ATPase assembly. This suggests that TMEM199 may have multiple functions depending on its subcellular localization - participating in V-ATPase assembly in the ER/Golgi and regulating gene expression in the nucleus .

When designing experiments to study this relationship, researchers should consider using techniques that can distinguish between these different pools of TMEM199, such as subcellular fractionation combined with immunoblotting or immunofluorescence with high-resolution microscopy.

How do proton pump inhibitors affect TMEM199 function and expression?

Research has shown that the proton pump inhibitor (PPI) omeprazole significantly decreases TMEM199 protein levels . Corresponding to this decrease, CD274 (PD-L1) mRNA expression is also largely reduced by omeprazole treatment . This suggests that TMEM199 can be pharmacologically targeted as an immune regulator.

This finding has important implications for cancer immunotherapy, as PPIs are commonly prescribed medications that might influence immune checkpoint expression. PPI application has been observed to disrupt immune therapy in clinical settings, attracting increasing attention from researchers .

Current research is focused on understanding the role of TMEM199 in influencing PPI immunotherapy interactions, with the goal of developing alternative medications for patients receiving both immunotherapy and chemotherapy .

PPI Impact on TMEM199 and Related Pathways
Observation: Omeprazole decreases TMEM199 protein levels
Downstream Effect: Reduced CD274 (PD-L1) mRNA expression
Clinical Relevance: Potential disruption of immune therapy effectiveness
Research Direction: Development of alternative drugs for immunotherapy patients requiring acid suppression

What are the recommended controls when studying TMEM199 knockdown effects?

When designing experiments to study TMEM199 knockdown effects, several controls should be included to ensure reliable and interpretable results:

  • Multiple siRNA or shRNA targets: Use at least 3-4 different siRNA or shRNA sequences targeting different regions of TMEM199 to minimize off-target effects. The search results mention four different target sequences for both mouse and human TMEM199 .

  • Scrambled siRNA/shRNA control: Include a non-targeting siRNA or shRNA with similar nucleotide composition as a negative control.

  • Rescue experiments: To confirm specificity, perform rescue experiments by reintroducing siRNA/shRNA-resistant TMEM199 constructs. This approach has been used to demonstrate that when TMEM199 expression is restored, PD-L1 levels also recover .

  • Functional validation: Assess both mRNA (using qRT-PCR) and protein levels (using western blotting) to confirm knockdown efficiency.

  • In vitro vs. in vivo controls: When comparing in vitro and in vivo effects, it's important to use the same cell lines and knockdown constructs, as TMEM199 shows different effects in these two contexts .

  • Lysosomal function controls: Since TMEM199 affects lysosomal function, include controls measuring lysosomal quantity and function, such as LysoTracker staining .

  • Protein degradation controls: When studying effects on protein levels, include translation inhibition conditions (e.g., cycloheximide treatment) to distinguish between effects on protein synthesis versus degradation .

What techniques are recommended for studying TMEM199's role in CD274 transcriptional regulation?

Based on published methodologies, the following techniques are recommended for studying TMEM199's role in CD274 transcriptional regulation:

  • Cut&Tag assay: This technique has proven effective for globally exploring nuclear TMEM199 functions and identifying its genomic binding sites, particularly in relation to CD274 and its transcriptional regulators .

  • Chromatin Immunoprecipitation (ChIP): While not explicitly mentioned in the search results, ChIP would be complementary to Cut&Tag for confirming TMEM199 binding to specific promoter regions.

  • Transcription factor knockdown experiments: Knockdown of putative transcription factors (IFNGR1, IRF1, c-Jun, KAT8, Trim28) in conjunction with TMEM199 modulation can help establish the regulatory network. This approach has successfully demonstrated that these factors work with TMEM199 to regulate CD274 expression .

  • qRT-PCR for mRNA quantification: This technique is essential for measuring CD274 mRNA levels in response to TMEM199 modulation and/or transcription factor knockdown .

  • Co-immunoprecipitation (Co-IP): To investigate physical interactions between TMEM199 and transcription factors or cofactors.

  • Reporter gene assays: Construct CD274 promoter-reporter plasmids to directly assess how TMEM199 and associated transcription factors influence promoter activity.

  • IFNγ stimulation: Since PD-L1 expression can be induced by IFNγ, including IFNγ stimulation conditions can help reveal how TMEM199 influences this regulatory pathway .

How can the dual localization of TMEM199 be reconciled in experimental designs?

Reconciling TMEM199's dual localization (ER/Golgi and nuclear) presents a significant methodological challenge. The following approaches can help address this challenge:

  • High-resolution confocal microscopy with appropriate co-staining for ER/Golgi and nuclear markers can visualize different pools of TMEM199. Z-stack imaging is particularly important to distinguish true nuclear localization from perinuclear staining .

  • Subcellular fractionation optimization: Careful optimization of fractionation protocols is essential, as standard protocols may not efficiently separate membrane-bound organelles from the nuclear fraction. Multiple fractionation methods should be compared, and rigorous controls for fraction purity are crucial .

  • Domain mapping experiments: Creating truncated variants of TMEM199 can help identify which domains are responsible for different localizations. This approach has successfully determined regions necessary for nuclear localization .

  • Live-cell imaging with photoactivatable or photoswitchable TMEM199 fusions could track the dynamics and potential movement between compartments.

  • Proximity labeling techniques (BioID or APEX) with TMEM199 fused to biotin ligase or peroxidase can identify distinct interactomes in different cellular compartments.

  • Selective inhibition approaches: Using compounds that specifically disrupt one pool of TMEM199 without affecting the other can help distinguish their respective functions.

  • Context-dependent expression analysis: Analyzing TMEM199 localization under different cellular conditions (e.g., stress, cell cycle phases, differentiation states) may reveal regulatory mechanisms controlling its distribution.

What are the key considerations when interpreting conflicting data about TMEM199 localization?

When faced with conflicting data about TMEM199 localization, as seen in the literature where different groups have reported ER, ER-to-Golgi, or nuclear localization , researchers should consider several factors:

  • Cell type specificity: TMEM199 localization may vary between cell types. The conflicting reports used different cell lines, which could explain the discrepancies .

  • Antibody specificity: Different antibodies may recognize different epitopes or conformations of TMEM199, potentially missing certain pools of the protein. Validation with multiple antibodies and tagged constructs is recommended .

  • Detection method sensitivity: Some methods may not be sensitive enough to detect low-abundance pools of TMEM199 in certain compartments.

  • Fixation and permeabilization protocols: These can significantly affect the preservation and accessibility of different cellular compartments. The search results mention specific protocols for immunofluorescence that successfully detected nuclear TMEM199 .

  • Dynamic localization: TMEM199 localization might change in response to cellular conditions or stimuli, such as stress or immune signaling.

  • Protein tagging artifacts: N- or C-terminal tags might disrupt localization signals. Compare results with different tag positions and untagged protein detection .

  • Alternative splicing or post-translational modifications: These could generate TMEM199 variants with different localizations.

  • Confirmation with orthogonal techniques: When possible, use multiple complementary techniques (e.g., microscopy, fractionation, proximity labeling) to verify localization findings.

What are promising therapeutic approaches targeting TMEM199?

The recent discoveries about TMEM199's role in immune regulation suggest several promising therapeutic approaches:

  • Proton pump inhibitor (PPI) repurposing: The finding that omeprazole significantly decreases TMEM199 protein levels and consequently reduces CD274 (PD-L1) mRNA expression suggests that existing PPIs might be repurposed for immune modulation in certain contexts .

  • Selective TMEM199 inhibitors: Developing compounds that specifically target TMEM199, particularly its nuclear function, could provide more precise modulation of PD-L1 expression without the broader effects of PPIs.

  • Nuclear localization disruptors: Compounds that specifically prevent nuclear localization of TMEM199 while preserving its ER/Golgi functions could selectively target its immune regulatory role.

  • Combination therapies: Since TMEM199 influences PD-L1 expression, combining TMEM199 inhibition with existing immune checkpoint inhibitors might enhance immunotherapy efficacy .

  • Transcription factor targeting: Disrupting specific interactions between TMEM199 and transcription factors like IFNGR1, IRF1, or Trim28 could provide another approach to modulate its effects on CD274 transcription .

  • Cancer-specific delivery: Developing methods to deliver TMEM199-targeting therapies specifically to cancer cells could enhance anti-tumor immune responses while minimizing systemic effects.

Current research is exploring how TMEM199 influences PPI immunotherapy, with the goal of developing alternative medications for patients receiving both immunotherapy and acid-suppression therapy .

What are the critical unanswered questions about TMEM199 function?

Despite recent advances, several critical questions about TMEM199 remain unanswered:

  • Regulatory mechanisms of subcellular localization: How is TMEM199 transported to the nucleus? What signals or conditions regulate its distribution between the ER/Golgi and nucleus?

  • Tissue-specific functions: Does TMEM199 have different roles in different tissues, particularly in relation to its dual localization and immune regulatory functions?

  • Developmental roles: Given that TMEM199 mutations cause developmental abnormalities, what are its functions during development?

  • Immune regulation beyond PD-L1: Does TMEM199 regulate other immune checkpoints or inflammatory pathways beyond CD274/PD-L1?

  • Relationship to V-ATPase: How does nuclear TMEM199 function relate to its role in V-ATPase assembly? Are these completely separate functions or somehow coordinated?

  • Post-translational modifications: What modifications regulate TMEM199 function, stability, or localization?

  • Interaction partners: What is the complete interactome of TMEM199 in different cellular compartments?

  • Evolutionary conservation: How conserved are TMEM199's dual functions across species? Do other V-ATPase assembly factors have similar nuclear roles?

  • Connection to other diseases: Beyond CDG and cancer, is TMEM199 dysregulation involved in other pathologies, particularly immune-related disorders?

  • Therapeutic targeting: Can TMEM199 be selectively targeted without disrupting essential cellular functions? What would be the long-term consequences of TMEM199 inhibition?

Addressing these questions will require integrated approaches combining structural biology, systems biology, animal models, and clinical studies to fully understand TMEM199's complex functions and therapeutic potential.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.