Recombinant Human Transmembrane protein 200B (TMEM200B)

Shipped with Ice Packs
In Stock

Description

Gene Information

GeneCards reports that TMEM200B is a protein-coding gene also known as Transmembrane Protein 200B .

Associated Diseases

TMEM200B is associated with diseases such as anal canal squamous cell carcinoma and lung non-small cell carcinoma .

TMEM100 Role in Colorectal Cancer

TMEM100 promotes the ubiquitination of HIF-1α, leading to HIF-1α degradation via the 26S proteasome pathway, and suppresses the migration and angiogenesis induction capacities of CRC cells by enhancing HIF-1α degradation via the ubiquitination/proteasome pathway . TMEM100 modulates the TGF-β signaling pathway in CRC, inhibits migration and the EMT process in CRC, and is an important downstream gene of the BMP9/BMP10 signaling pathway .

TMEM205 and Cisplatin Resistance

Research indicates that the transmembrane protein TMEM205 is overexpressed in cancer cells resistant to cisplatin . TMEM205 expression is associated with cisplatin resistance, and the protein is located at the cell surface . The presence of TMEM205 in the membrane is sufficient to counteract the toxic effect of cisplatin, possibly through cisplatin binding/sequestration or direct TMEM205-mediated extrusion across the lipid bilayer .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
TMEM200B; TTMB; Transmembrane protein 200B; Transmembrane protein TTMA; Two transmembrane domain-containing family member B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-307
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
TMEM200B
Target Protein Sequence
MTAGSPEECGEVRRSPEGRVSRLGRRLGRRRRPRSPPEPLRVRARLRLRSPSGAFAALGA LVVLVGMGIAVAGYWPHRAGAPGSRAANASSPQMSELRREGRGGGRAHGPHERLRLLGPV IMGVGLFVFICANTLLYENRDLETRRLRQGVLRAQALRPPDGPGWDCALLPSPGPRSPRA VGCAEPEIWDPSPRRGTSPVPSVRSLRSEPANPRLGLPALLNSYPLKGPGLPPPWGPRTQ TGHVIITVQPSGSCIEHSKSLDLGLGELLLGAPAARDCAHRSWPRLDRLSLGGYAKLGGG GDLGARV
Uniprot No.

Target Background

Database Links

HGNC: 33785

KEGG: hsa:399474

UniGene: Hs.712722

Protein Families
TMEM200 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is TMEM200B and what is its role in cellular function?

TMEM200B (Transmembrane Protein 200B) is a protein-coding gene that produces a transmembrane protein. Like other transmembrane proteins, it likely spans the cellular membrane and may play roles in cell signaling, transport, or structural integrity. While information on human TMEM200B remains limited, research on TMEM200B in other species such as Ovis aries (sheep) provides some insights into its genetic structure . The functional characterization of TMEM200B remains an active area of investigation, with researchers typically employing comparative genomics, proteomics, and functional studies to elucidate its biological significance.

When approaching TMEM200B research, investigators should consider the following methodological approach:

  • Perform sequence homology analysis across species

  • Examine tissue expression patterns

  • Identify potential binding partners

  • Investigate subcellular localization

  • Conduct functional assays based on predicted domains

How does the structure of TMEM200B compare to other transmembrane proteins?

TMEM200B belongs to the broader family of transmembrane proteins. Structural analysis typically involves computational prediction followed by experimental validation. Based on sequence analysis of TMEM200B in model organisms, researchers can predict transmembrane domains, potential glycosylation sites, and functional motifs.

When investigating TMEM200B structure, consider:

  • Using hydropathy plot analysis to identify transmembrane domains

  • Employing structure prediction software such as I-TASSER or Phyre2

  • Comparing conserved domains with other TMEM family proteins

  • Analyzing potential post-translational modification sites

  • Validating predictions through circular dichroism, NMR, or where possible, X-ray crystallography

Unlike some well-characterized membrane proteins that have been successfully crystallized, obtaining high-resolution structural data for many transmembrane proteins remains challenging due to their hydrophobic nature and difficulties in expression and purification .

What expression systems are suitable for recombinant TMEM200B production?

Several expression systems can be considered for recombinant TMEM200B production, each with distinct advantages:

Expression SystemAdvantagesLimitationsRecommended Use
HEK293T cellsMammalian post-translational modifications, proper foldingHigher cost, lower yieldFunctional studies requiring native protein conformation
HEK293S GnTi- cellsSuitable for structural studies, reduced glycosylation heterogeneitySpecialized culture requirementsX-ray crystallography, cryo-EM studies
Sf9 insect cellsHigher yield than mammalian, some PTMsDifferent glycosylation patternLarge-scale production, antibody generation
E. coliHigh yield, low costLimited PTMs, inclusion body formationDomain studies, antibody generation

The methodological approach would involve:

  • Cloning the TMEM200B gene into an appropriate expression vector

  • Small-scale expression trials in different systems

  • Western blot validation of expression

  • Optimization of culture conditions

  • Scale-up production based on application requirements

For structural or functional studies requiring proper protein folding and post-translational modifications, mammalian expression systems such as HEK293T or HEK293S GnTi- cells transduced with baculovirus often provide the best results for transmembrane proteins .

What are the optimal purification strategies for recombinant human TMEM200B?

Purification of recombinant human TMEM200B presents significant challenges due to its hydrophobic transmembrane domains. A methodological approach would include:

  • Membrane fraction isolation:

    • Harvest cells expressing TMEM200B

    • Disrupt cells using mechanical methods (sonication, French press)

    • Separate membrane fraction by ultracentrifugation

  • Solubilization screening:

    • Test multiple detergents (DDM, LMNG, GDN, CHAPS)

    • Optimize detergent concentration, temperature, and time

    • Analyze by Western blot to confirm solubilization efficiency

  • Chromatography purification:

    • Immobilized metal affinity chromatography (IMAC) using His-tag

    • Size exclusion chromatography for further purification

    • Optional ion exchange chromatography based on isoelectric point

  • Quality assessment:

    • SDS-PAGE and Western blot analysis

    • Mass spectrometry confirmation

    • Circular dichroism to assess secondary structure integrity

The choice of detergent is critical, as it must effectively solubilize TMEM200B while preserving its native structure. Based on experience with similar transmembrane proteins, mild detergents like DDM (n-Dodecyl β-D-maltoside) or LMNG (Lauryl Maltose Neopentyl Glycol) often provide a good balance between solubilization efficiency and structural preservation .

How can researchers overcome aggregation issues when working with recombinant TMEM200B?

Transmembrane proteins are notorious for aggregation during expression and purification. For TMEM200B, consider these methodological approaches:

  • Expression optimization:

    • Reduce expression temperature (28-30°C instead of 37°C)

    • Use weaker promoters to slow expression rate

    • Add chemical chaperones to culture media (glycerol, DMSO at low concentrations)

  • Solubilization strategies:

    • Screen detergent mixtures rather than single detergents

    • Include lipids during solubilization (cholesterol, phosphatidylcholine)

    • Test protein stabilizing additives (glycerol, specific ions)

  • Purification considerations:

    • Maintain detergent above critical micelle concentration throughout

    • Include reducing agents if cysteine residues are present

    • Consider protein stabilizers like arginine or glutamic acid

    • Perform size exclusion chromatography to remove aggregates

  • Storage recommendations:

    • Avoid freeze-thaw cycles

    • Store at higher concentrations with glycerol (20-25%)

    • Consider reconstitution into nanodiscs or liposomes for long-term stability

Based on experience with other transmembrane proteins, maintaining TMEM200B in a native-like lipid environment as soon as possible after extraction can significantly reduce aggregation tendencies .

What are the current challenges in determining TMEM200B interacting partners?

Identifying protein-protein interactions for transmembrane proteins like TMEM200B presents unique challenges:

  • Methodological limitations:

    • Traditional yeast two-hybrid systems are poorly suited for membrane proteins

    • Co-immunoprecipitation requires effective antibodies and mild solubilization

    • In vivo crosslinking efficiency can be limited by membrane environment

  • Recommended approaches:

    • Proximity labeling techniques (BioID, APEX)

    • Split-protein complementation assays modified for membrane proteins

    • FRET/BRET-based interaction studies

    • Co-immunoprecipitation with optimized mild detergents

    • Mass spectrometry after stabilized isolation of membrane complexes

  • Validation strategies:

    • Reciprocal pull-downs with tagged potential partners

    • Functional assays to test biological relevance of interactions

    • Co-localization studies using super-resolution microscopy

    • In silico docking combined with mutagenesis of predicted interfaces

The field continues to develop improved techniques for studying membrane protein interactions, with proximity labeling methods showing particular promise for identifying transient or weak interactions that may be disrupted during traditional co-immunoprecipitation approaches.

How should researchers design experiments to characterize TMEM200B function?

Characterizing the function of poorly understood proteins like TMEM200B requires a systematic approach:

  • Expression pattern analysis:

    • qRT-PCR across tissue panels

    • Immunohistochemistry with validated antibodies

    • Single-cell RNA-seq data mining from public repositories

    • Western blot analysis of fractionated cellular components

  • Loss-of-function studies:

    • CRISPR-Cas9 knockout/knockdown

    • siRNA/shRNA-mediated silencing

    • Dominant negative mutant expression

    • Comparison of phenotypes across multiple cell types

  • Gain-of-function approaches:

    • Overexpression studies with controlled expression levels

    • Inducible expression systems to examine temporal effects

    • Heterologous expression in different cell backgrounds

  • Domain mapping:

    • Generation of truncation mutants

    • Point mutations of conserved residues

    • Domain swapping with related proteins

    • Chimeric protein analysis

Each approach should include appropriate controls and be performed in biological triplicates at minimum. For transmembrane proteins, subcellular localization studies are particularly important and should employ markers for various cellular compartments to precisely determine where TMEM200B functions.

What control experiments are essential when studying recombinant TMEM200B?

Robust control experiments are critical for valid interpretation of TMEM200B research:

  • Expression validation controls:

    • Empty vector transfections

    • Expression of unrelated transmembrane protein

    • Untransfected cells processed identically

    • Western blot with multiple antibodies (tag and protein-specific)

  • Localization study controls:

    • Co-localization with established organelle markers

    • Comparison of tagged versus untagged protein localization

    • Different tag positions (N-terminal vs. C-terminal) to assess tag interference

    • Treatment with trafficking inhibitors to confirm pathway

  • Functional assay controls:

    • Rescue experiments in knockout/knockdown systems

    • Inactive mutant versions (e.g., catalytic site mutations if enzymatic)

    • Dose-dependency analysis

    • Time course studies to establish causality

  • Interaction study controls:

    • Reversed immunoprecipitation

    • Competition assays with untagged protein

    • Detergent sensitivity tests

    • Negative control proteins with similar localization but no expected interaction

When designing these controls, researchers should consider the principle of changing only one variable at a time and include both positive and negative controls in every experiment.

How can researchers generate reliable antibodies against human TMEM200B?

Developing specific antibodies against transmembrane proteins presents unique challenges due to their hydrophobic nature and potential limited exposed epitopes:

  • Antigen selection strategies:

    • Extracellular loops (preferred for live cell applications)

    • Intracellular domains (typically more hydrophilic)

    • Peptide antigens from predicted surface-exposed regions

    • Recombinant soluble domains expressed separately

  • Production approaches:

    • Peptide synthesis followed by carrier protein conjugation

    • Recombinant fusion proteins with solubility enhancers

    • DNA immunization with full-length sequence

    • Genetic immunization using viral vectors

  • Screening methodology:

    • ELISA against immunizing antigen

    • Western blot against recombinant protein and endogenous sources

    • Immunoprecipitation followed by mass spectrometry

    • Immunofluorescence with overexpression systems versus knockdown controls

  • Validation requirements:

    • Signal absence in knockout/knockdown systems

    • Peptide competition assays

    • Cross-reactivity testing against related proteins

    • Comparison of multiple antibodies targeting different epitopes

For TMEM200B, focusing on unique regions that differentiate it from other TMEM family members is essential for specificity. Commercial antibody development services can be employed, but rigorous validation remains the researcher's responsibility regardless of the source.

How should researchers interpret TMEM200B expression data across different tissues?

Analyzing TMEM200B expression patterns requires consideration of several factors:

  • Normalization approaches:

    • Use multiple reference genes for qRT-PCR

    • Consider tissue-specific reference genes rather than "universal" controls

    • Apply geometric averaging of multiple references

    • For proteomics, normalize to membrane fraction rather than total protein

  • Expression pattern analysis:

    • Compare across developmental stages

    • Examine disease versus normal tissue

    • Consider cell-type specific expression in heterogeneous tissues

    • Correlate mRNA and protein levels to identify post-transcriptional regulation

  • Comparative analysis framework:

    • Examine co-expression with functional partners

    • Compare with related TMEM family members

    • Analyze species conservation of expression patterns

    • Correlate with tissue-specific functions

  • Data presentation recommendations:

    • Display individual replicates rather than only means

    • Include statistical analysis with appropriate tests

    • Consider data transformations for non-normally distributed data

    • Present both relative and absolute quantification where possible

When interpreting TMEM200B expression data, researchers should consider that membrane proteins may have different extraction efficiencies across tissues, potentially confounding quantitative comparisons if not carefully controlled.

What bioinformatic approaches are most valuable for predicting TMEM200B function?

Computational analysis can provide valuable insights into TMEM200B function:

  • Sequence-based predictions:

    • Transmembrane domain prediction (TMHMM, Phobius)

    • Signal peptide analysis (SignalP)

    • Post-translational modification sites (NetPhos, NetOGlyc)

    • Conserved domain searches (PFAM, SMART)

  • Evolutionary analysis:

    • Phylogenetic comparisons across species

    • Selection pressure analysis (dN/dS ratio)

    • Identification of conserved residues

    • Synteny analysis for genomic context

  • Protein-protein interaction predictions:

    • STRING database mining

    • Structural docking if domains are modeled

    • Coevolution analysis for interacting surfaces

    • Text mining of scientific literature

  • Function prediction integration:

    • Gene Ontology enrichment of co-expressed genes

    • Pathway analysis of potential interactors

    • Disease association through GWAS data mining

    • Phenotype association from model organism databases

How can researchers differentiate between specific and non-specific effects in TMEM200B functional studies?

Distinguishing genuine TMEM200B functions from experimental artifacts requires rigorous controls and validation:

  • Dose-dependency assessment:

    • Titrate expression levels using inducible systems

    • Correlate phenotypic changes with protein levels

    • Establish clear thresholds for biological effects

    • Compare with related proteins at equivalent expression levels

  • Rescue experiment design:

    • CRISPR knockout followed by re-expression

    • Use of RNAi-resistant constructs for knockdown rescue

    • Complementation with orthologues from different species

    • Domain-specific rescue to map functional regions

  • Specificity controls:

    • Parallel analysis of related TMEM family members

    • Unrelated transmembrane proteins with similar localization

    • Point mutants affecting key predicted functional residues

    • Chemical inhibitors where applicable

  • Temporal analysis:

    • Time-course studies to establish causality

    • Pulse-chase approaches for dynamic processes

    • Inducible systems for acute versus chronic effects

    • Reversibility testing after stimulus removal

Researchers should be particularly cautious about overexpression artifacts when studying transmembrane proteins, as these can lead to mislocalization, aggregation, or unphysiological interactions. Whenever possible, studies should be performed at near-endogenous expression levels.

What are the most promising future directions for TMEM200B research?

Based on current understanding of transmembrane proteins and the limited information available specifically for TMEM200B, several research directions show particular promise:

  • Structural biology approaches:

    • Cryo-EM studies of purified TMEM200B

    • NMR analysis of individual domains

    • Hydrogen-deuterium exchange mass spectrometry for dynamics

    • Computational modeling validated by experimental constraints

  • Functional genomics:

    • CRISPR screening in relevant cellular contexts

    • Single-cell transcriptomics after perturbation

    • Conditional knockout animal models

    • Tissue-specific expression modulation

  • Disease relevance investigation:

    • Analysis of genetic variants in human populations

    • Examination of expression changes in disease states

    • Drug screening for modulators of TMEM200B function

    • Potential as a biomarker or therapeutic target

  • Technological innovations:

    • Development of specific small molecule probes

    • Engineered TMEM200B variants as research tools

    • Advanced imaging approaches for tracking in live cells

    • Proximity labeling to map the TMEM200B interactome

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.