Recombinant Human Transmembrane protein 200C (TMEM200C)

Shipped with Ice Packs
In Stock

Description

Introduction to TMEM200C

TMEM200C, also known as TTMA, is a protein-coding gene located on chromosome 18 in the human genome . As a transmembrane protein, it is integrated into cellular membranes, with portions extending into both intracellular and extracellular spaces. The gene encodes a protein that belongs to the broader family of transmembrane proteins, which play crucial roles in various cellular processes including signal transduction, molecular transport, and cell-cell interactions.

The complete TMEM200C protein consists of 621 amino acids, forming a complex molecular structure with multiple membrane-spanning domains . While the fundamental characterization of this protein has been established, many aspects of its specific biological functions remain under investigation. The recombinant form of this protein has become increasingly important for research purposes, allowing scientists to study its structure, function, and potential applications in biomedical contexts.

Genomic Location and Organization

TMEM200C is positioned on the negative strand of chromosome 18, specifically at genomic coordinates 18:5882072-5895955 . The gene has alternative transcripts, including TMEM200C_ENST00000383490, highlighting the complexity of its expression and potential functional diversity . This genomic organization contributes to the regulation of TMEM200C expression in different tissues and developmental stages.

Protein Structure and Domains

The full-length human TMEM200C protein consists of 621 amino acids, with recombinant versions typically focusing on specific fragments, such as amino acids 385-621 . The amino acid sequence of this region is:

QGGRDRGGDAEGASCSWQRPPGERGSQEIPRGELDLSMTNLRGAEGSMRGARREPEEPEGAVAARAARGQGGRLPRTGRYAALRRRSTSGLPDYRAPPSPEPPPSPGSADPDSSPLAKAASPSPPLRLEGSPPTRRDSGSSQSDDPSSSNKGYTPLREAGTSTESVLDAVAGQTRDSAVAAPVLGAEQSSPEGASQEPPTAEQPQPVQRQFTNKEKLIMISRSHAIGVEEELESTGI

This sequence reveals important structural elements that contribute to the protein's function, including potential sites for post-translational modifications and protein-protein interactions. The transmembrane domains are particularly significant for the protein's integration into cellular membranes and subsequent biological activities.

Expression Systems and Methodologies

Recombinant human TMEM200C is typically produced using bacterial expression systems, with Escherichia coli (E. coli) being a common host organism . The production process involves inserting the human TMEM200C gene sequence into appropriate expression vectors, followed by transformation into bacterial cells. These engineered bacteria then express the human protein, which can be subsequently purified for research applications.

For enhanced purification and detection capabilities, recombinant TMEM200C is often tagged with affinity markers such as polyhistidine (His-tag) . This approach facilitates easier isolation of the protein from bacterial lysates using affinity chromatography techniques, resulting in higher purity samples for experimental use.

Purification and Quality Control

The purification process for recombinant TMEM200C typically involves multiple chromatographic steps to ensure high purity. After expression in E. coli, the protein undergoes purification to remove bacterial proteins and other contaminants. The final product is often lyophilized from sterile PBS (58mM Na₂HPO₄, 17mM NaH₂PO₄, 68mM NaCl, pH 7.4) with protective agents such as 5% trehalose and 5% mannitol to enhance stability during storage .

Quality control measures include SDS-PAGE with Coomassie Brilliant Blue staining to verify protein purity, which typically reaches approximately 90% for commercial preparations . This ensures that the recombinant protein is suitable for downstream research applications.

Predicted Protein Interactions

Protein interaction studies using tools like STRING suggest that TMEM200C may interact with several protein partners, indicating potential roles in various cellular processes . These predicted functional partners include:

Protein PartnerInteraction ScoreFunctional Relevance
MTHFSD0.546Methenyltetrahydrofolate synthase domain-containing protein
SYCP2L0.542Regulates survival of primordial oocytes
ALB0.532Major plasma protein with binding capacity for various molecules
GDF70.509May play a role in the motor area of the primate neocortex
C18orf250.479Uncharacterized protein on chromosome 18
SYCP20.461Component of synaptonemal complexes during meiotic prophase
RNF1650.439E3 ubiquitin-protein ligase, regulator of motor axon elongation
L3MBTL40.422Putative Polycomb group protein
ADCY10.411Catalyzes formation of cAMP in response to G-protein signaling
ARTN0.405Supports survival of sensory and sympathetic peripheral neurons

These interactions suggest potential involvement of TMEM200C in diverse cellular processes, including neural development, reproductive biology, and cellular signaling pathways .

Cancer Research Connections

According to the COSMIC (Catalogue of Somatic Mutations in Cancer) database, TMEM200C has been observed to have mutations in cancer samples, with 497 unique samples showing mutations out of 49,034 samples analyzed . Despite these observations, TMEM200C is not currently classified as a known cancer gene and is not found in the Cancer Gene Census . Additionally, it is not designated as an expert curated gene in this context.

The presence of somatic mutations in TMEM200C across cancer samples suggests potential involvement in cancer biology, though the precise nature of this relationship requires further investigation. Current evidence does not support TMEM200C as a cancer driver gene, but rather suggests it may be part of broader genetic alterations occurring in cancerous tissues.

Neurological Considerations

Interestingly, one of TMEM200C's predicted interaction partners, ARTN (Artemin), is known to support the survival of sensory and sympathetic peripheral neurons in culture, as well as dopaminergic neurons of the ventral mid-brain . While this does not directly implicate TMEM200C in neurological functions, it suggests potential indirect involvement in neural pathways through protein-protein interactions.

Chemical Compounds Affecting TMEM200C Expression

Studies in rat models have identified several chemical compounds that interact with and affect the expression of TMEM200C. These interactions provide insights into the regulation of this gene and potential environmental factors that may influence its function .

Key chemical interactions include:

Chemical CompoundEffect on TMEM200CEvidence TypeReference
Bisphenol ADecreases expressionExperimentalPMID:25181051, PMID:34947998
Bisphenol AIncreases expressionExperimentalPMID:33296240
Bisphenol AIncreases methylationExperimentalPMID:28505145
Aflatoxin B1Decreases methylationISOPMID:27153756
Aflatoxin B1Increases methylation (intron)ISOPMID:30157460
6-propyl-2-thiouracilAffects expressionExperimentalPMID:24780913
Benzo[a]pyreneAffects methylationISOPMID:27901495

The contradictory effects of bisphenol A on TMEM200C expression suggest complex regulatory mechanisms that may depend on specific cellular contexts, exposure concentrations, or experimental conditions . These interactions highlight the sensitivity of TMEM200C to environmental factors and chemical exposures.

Epigenetic Regulation

The methylation changes observed in response to various chemical compounds indicate that TMEM200C is subject to epigenetic regulation . Specifically, the differential methylation patterns induced by compounds like aflatoxin B1 and bisphenol A suggest that environmental exposures may influence TMEM200C activity through epigenetic mechanisms, potentially impacting its expression and function in various physiological or pathological contexts.

Recombinant TMEM200C Preparations

Recombinant human TMEM200C protein is commercially available for research purposes, typically as His-tagged preparations expressed in bacterial systems. These products are designed for use in various research applications, including protein-protein interaction studies, antibody development, and functional characterization .

Commercially available recombinant TMEM200C typically includes:

Product CharacteristicSpecification
Amino Acid Range385-621 aa
Expression SystemE. coli
TagHis
FormLyophilized from sterile PBS with 5% trehalose and 5% mannitol
PurityApproximately 90% by SDS-PAGE
Storage RecommendationsShort-term: 2-8°C (1-2 weeks); Long-term: -20°C to -80°C (up to 3 months)
Reconstitution0.25 μg/μl in 200 μl sterile water (short-term) or 50% glycerol solution (long-term)

These standardized preparations facilitate consistent experimental outcomes in research settings, enabling scientists to investigate the properties and functions of TMEM200C across different study designs .

Research Applications

Recombinant TMEM200C finds applications in various research contexts, including:

  1. Structural biology studies to understand the three-dimensional organization of the protein

  2. Development of antibodies and other research reagents targeting TMEM200C

  3. Investigation of protein-protein interactions involving TMEM200C

  4. Functional studies to elucidate the biological roles of TMEM200C

  5. Disease-related research examining potential connections to pathological conditions

Despite these applications, the relatively limited knowledge about TMEM200C's specific functions suggests that significant research opportunities remain in this area.

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. If you have a specific format requirement, please indicate it when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. For specific delivery estimates, please contact your local distributor.
All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which you can use as a reference.
Shelf Life
The shelf life of our proteins depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot the protein for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us, and we will prioritize the development of your specified tag.
Synonyms
TMEM200C; TTMA; Transmembrane protein 200C; Transmembrane protein TTMA; Two transmembrane domain-containing family member A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-621
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
TMEM200C
Target Protein Sequence
MIATGGLLRISARKQDPLRPPSQIPKRKRKAKKRRKNDVVVVKGKLKLCSISGLIALCGI LVLLVGIAMAVVGYWPKATGTNREGGKQLPPAGSSHRVPTTANSSSSGSKNRSRSHPRAP GGVNSSSAGAPRSTPPARAASPSSSSTSVGFFFRIFSGYLHSDKLKVFGPLIMGIGIFLF ICANAVLHENRDKKTKIINLRDLYSTVIDVHSLRAKDLAAAAAAAAAAAASSSSSAPAAA PPGAIPLNGFLSYVQSRGLELKPGGCGGSGDAFGAAAMLAKGSWPPHPAAPSGGRPRGAA SPPDLASSPRCPREPPSLAEAVYSVYRERSGVAGSRRAAAATAAAAASSCSSPAPCSPPE SWGRQSTASSFVDSSLSAFALLPLQGGRDRGGDAEGASCSWQRPPGERGSQEIPRGELDL SMTNLRGAEGSMRGARREPEEPEGAVAARAARGQGGRLPRTGRYAALRRRSTSGLPDYRA PPSPEPPPSPGSADPDSSPLAKAASPSPPLRLEGSPPTRRDSGSSQSDDPSSSNKGYTPL REAGTSTESVLDAVAGQTRDSAVAAPVLGAEQSSPEGASQEPPTAEQPQPVQRQFTNKEK LIMISRSHAIGVEEELESTGI
Uniprot No.

Target Background

Database Links

HGNC: 37208

KEGG: hsa:645369

Protein Families
TMEM200 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is TMEM200C and what is its significance in cancer research?

Methodologically, researchers investigating TMEM200C should consider both gene expression analysis at the mRNA level and protein detection through immunohistochemistry to establish baseline expression in normal tissues before comparing with pathological samples.

How does TMEM200C expression compare between normal and tumor tissues?

While specific comparative studies focusing exclusively on TMEM200C are still emerging, research approaches can be informed by methodologies used with other TMEM family members. For instance, TMEM200A shows significantly higher expression in gastric cancer tissues compared to adjacent non-tumor tissues (P = 1.382e−05) . Similar differential expression patterns have been observed with other TMEM family proteins across various cancer types .

To study TMEM200C expression differences, researchers typically employ:

  • RNA-seq analysis of tumor versus matched normal tissues

  • RT-qPCR validation of expression differences

  • Meta-analysis of expression data from public databases like TCGA and GEO

  • Experimental verification in cell lines representing normal and malignant tissues

The methodological approach should include statistical testing (Mann-Whitney U test, Student's t-test, or ANOVA) to validate expression differences, with P-values <0.05 considered statistically significant .

What are the current methods for measuring TMEM200C expression in tissue samples?

Researchers employ multiple complementary techniques to quantify TMEM200C expression:

  • RT-qPCR: This remains the gold standard for mRNA expression quantification in both cell lines and clinical samples. The approach requires careful primer design specific to TMEM200C and appropriate housekeeping genes for normalization.

  • RNA-seq analysis: For genome-wide expression studies, RNA-seq data from platforms like Illumina can be analyzed using bioinformatics pipelines that include quality control, alignment, and differential expression analysis.

  • Protein detection: Western blotting and immunohistochemistry using validated antibodies against TMEM200C allow for protein-level detection and localization within cells and tissues.

  • Public database mining: Analysis of expression data from repositories such as TCGA, GEO, and Oncomine can provide preliminary evidence of expression patterns across large sample cohorts .

For optimal results, researchers should validate findings using multiple methodologies and include appropriate statistical analyses to determine significance of expression differences.

What statistical methods are most appropriate for analyzing TMEM200C expression data in survival studies?

For robust analysis of TMEM200C expression in relation to patient survival, researchers should employ a multi-tiered statistical approach:

An example statistical analysis framework based on similar TMEM protein studies:

Statistical MethodParametersSoftware Tools
Univariate Cox regressionP < 0.05 thresholdR (survival package)
LASSO Cox regressionPenalty parameter tuning by cross-validationR (glmnet package)
Multivariate Cox regressionHR with 95% CIR (survival package) or SPSS
Time-dependent ROCAUC values at 1-, 3-, 5-year timepointsR (timeROC package)

Researchers should report complete statistical parameters including HR values, 95% CI, and precise P-values to ensure reproducibility .

How can TMEM200C expression be correlated with immune cell infiltration in tumor microenvironment?

To investigate associations between TMEM200C expression and immune cell infiltration in the tumor microenvironment, researchers can implement the following methodological approach:

  • CIBERSORT analysis: This computational method enables estimation of the relative proportions of 22 immune cell types in tumor samples based on gene expression data. Samples can be divided into high and low TMEM200C expression groups (using median expression as the cutoff), followed by comparison of immune cell infiltration patterns between groups .

  • Correlation analysis: Calculate Spearman or Pearson correlation coefficients between TMEM200C expression and specific immune cell markers or scores.

  • Immunohistochemistry validation: Perform multiplex immunohistochemistry to directly visualize and quantify immune cell populations (CD8+ T cells, macrophages, etc.) in tissue sections with different TMEM200C expression levels.

  • Gene Set Enrichment Analysis (GSEA): Identify immune-related signaling pathways associated with TMEM200C expression levels. This approach can reveal whether TMEM200C expression correlates with specific immune response patterns .

Previous studies with TMEM200A revealed that CD8+ T cells are significantly decreased in tumors with high TMEM200A expression, while eosinophils are increased . Similar methodologies can be applied to investigate TMEM200C's relationship with immune cell populations, potentially revealing its role in immune evasion or immunomodulation within the tumor microenvironment.

What methods can be used to investigate the functional role of TMEM200C in cancer cells?

To elucidate the functional significance of TMEM200C in cancer cells, researchers should employ a comprehensive experimental approach:

  • Gene expression modulation:

    • Knockdown experiments: Using siRNA or shRNA to reduce TMEM200C expression

    • Overexpression studies: Transfecting cells with TMEM200C expression vectors

    • CRISPR-Cas9 gene editing: For complete knockout or targeted modifications

  • Functional assays:

    • Proliferation assays: MTT, CCK-8, or BrdU incorporation

    • Migration and invasion assays: Transwell, wound healing, and Matrigel invasion

    • Colony formation assays: To assess clonogenic potential

    • Apoptosis assays: Annexin V/PI staining and flow cytometry

    • Cell cycle analysis: Propidium iodide staining and flow cytometry

  • Pathway analysis:

    • Western blot: For detecting changes in key signaling proteins

    • Co-immunoprecipitation: To identify protein-protein interactions

    • Luciferase reporter assays: For studying promoter activity and transcriptional regulation

    • RNA-seq and pathway enrichment analysis: To identify global changes in gene expression

  • In vivo models:

    • Xenograft models: Injecting manipulated cancer cells into immunodeficient mice

    • Metastasis models: Tail vein or intracardiac injection for studying metastatic potential

    • Patient-derived xenografts: For more clinically relevant models

These methodological approaches can systematically characterize how TMEM200C influences cancer cell behavior, similar to studies conducted on other TMEM family proteins that have revealed roles in oncogenesis, tumor progression, and metastasis .

How can researchers develop a predictive signature incorporating TMEM200C for cancer prognosis?

Developing a robust prognostic signature that includes TMEM200C requires a systematic bioinformatics and validation approach:

This methodological framework has proven effective for other TMEM family proteins and can be adapted for TMEM200C-based signature development, potentially improving risk stratification and treatment decision-making for patients with cancers expressing this protein.

What are the challenges in developing recombinant TMEM200C protein for research applications?

Developing high-quality recombinant TMEM200C for research presents several technical challenges that researchers must address:

  • Expression system selection:

    • Bacterial systems: While cost-effective, they often fail to properly fold complex transmembrane proteins

    • Mammalian cell systems: Provide proper post-translational modifications but are more expensive and lower-yielding

    • Insect cell systems: Offer a balance between proper folding and yield for transmembrane proteins

  • Protein solubilization and purification:

    • Transmembrane proteins require careful detergent selection for solubilization

    • Commonly used detergents include n-dodecyl-β-D-maltoside (DDM), n-octyl-β-D-glucoside (OG), and digitonin

    • Purification typically requires multiple chromatography steps (affinity, ion exchange, size exclusion)

  • Protein stability considerations:

    • Recombinant transmembrane proteins often show limited stability outside their native membrane environment

    • Alternative approaches include:

      • Nanodiscs: Lipid bilayers stabilized by scaffold proteins

      • Liposomes: Artificial lipid vesicles

      • Amphipols: Amphipathic polymers that stabilize membrane proteins

  • Functional validation:

    • Biophysical characterization (circular dichroism, thermal shift assays) to confirm proper folding

    • Binding assays to verify interaction with known partners

    • Activity assays based on TMEM200C's putative functions

  • Tag selection and placement:

    • Tags (His, FLAG, GST) can interfere with protein folding or function

    • Consider removable tags with protease cleavage sites

    • Optimize tag placement (N- or C-terminal) based on protein topology

These methodological considerations are essential for developing functionally relevant recombinant TMEM200C that can be used for structural studies, antibody generation, protein-protein interaction studies, and other research applications critical for understanding its role in normal physiology and disease states.

How should researchers design experiments to study TMEM200C's role in tumor metastasis?

To effectively investigate TMEM200C's involvement in tumor metastasis, researchers should implement a comprehensive experimental strategy:

  • Clinical correlation studies:

    • Analyze TMEM200C expression in primary tumors versus metastatic lesions

    • Assess the relationship between TMEM200C expression and metastasis-free survival in patient cohorts

    • Perform multivariate analysis to determine if TMEM200C is an independent predictor of metastasis

  • In vitro metastasis modeling:

    • Cell models: Use cell lines with differential metastatic potential and compare TMEM200C expression

    • Migration/invasion assays: Transwell, wound healing, and 3D invasion assays after TMEM200C modulation

    • Adhesion assays: Measure cell attachment to extracellular matrix components

    • Epithelial-mesenchymal transition (EMT) analysis: Assess EMT markers (E-cadherin, vimentin, etc.) after TMEM200C modulation

  • In vivo metastasis models:

    • Orthotopic implantation: Inject TMEM200C-modulated cancer cells into the organ of origin

    • Experimental metastasis: Tail vein or intracardiac injection to study colonization capacity

    • Spontaneous metastasis: Primary tumor establishment followed by tracking of metastatic spread

    • Imaging: Use bioluminescence or fluorescence imaging to monitor metastasis in real-time

  • Molecular mechanism investigation:

    • Adhesion molecule profiling: Analyze expression of integrins and other adhesion molecules

    • Protease activity: Measure MMP expression and activity

    • Angiogenesis factors: Assess VEGF and other angiogenic factors

    • Pathway analysis: Identify signaling pathways (MAPK, PI3K/AKT, etc.) activated by TMEM200C

    • Gene expression profiling: RNA-seq after TMEM200C modulation to identify metastasis-related gene signatures

  • Validation in patient samples:

    • Immunohistochemistry on tissue microarrays containing primary tumors and matched metastases

    • Correlation of TMEM200C expression with known metastasis biomarkers

This systematic approach will provide comprehensive insights into TMEM200C's functional role in the metastatic cascade, potentially identifying novel therapeutic targets or prognostic indicators.

What genetic engineering approaches are most effective for studying TMEM200C function?

Researchers investigating TMEM200C function should consider these genetic engineering strategies, each with specific technical considerations:

  • CRISPR-Cas9 gene editing:

    • Complete knockout: Design guide RNAs targeting early exons of TMEM200C

    • Domain-specific mutations: Use homology-directed repair to introduce specific mutations

    • Knockin reporters: Insert fluorescent tags to monitor endogenous protein localization

    • CRISPRi/CRISPRa: For reversible repression or activation of TMEM200C expression

  • RNA interference:

    • siRNA: For transient knockdown experiments (3-5 days)

    • shRNA: For stable knockdown via lentiviral transduction

    • Design considerations: Use multiple target sequences to control for off-target effects

    • Validation: Confirm knockdown efficiency at both mRNA (qPCR) and protein (Western blot) levels

  • Overexpression systems:

    • Transient transfection: For short-term studies

    • Stable cell lines: Using selection markers for long-term experiments

    • Inducible expression: Tet-On/Off systems for controlled expression timing

    • Tagged constructs: Adding epitope tags (HA, FLAG) or fluorescent proteins (GFP, mCherry) for detection

  • Genome-wide screening approaches:

    • CRISPR screens: To identify genes synthetically lethal with TMEM200C

    • cDNA or ORF libraries: To identify enhancers or suppressors of TMEM200C function

    • Analysis: Use next-generation sequencing to identify hits from screens

  • Animal models:

    • Conditional knockout mice: Tissue-specific deletion using Cre-loxP system

    • Transgenic overexpression: Tissue-specific promoters driving TMEM200C expression

    • Patient-derived xenografts: With TMEM200C modulation for translational studies

Each approach has its advantages and limitations that should be considered when designing experiments to study TMEM200C function in cancer or other biological contexts.

How can researchers investigate the interaction between TMEM200C and other proteins in cellular pathways?

To systematically characterize TMEM200C's protein-protein interactions and pathway involvement, researchers should employ multiple complementary approaches:

  • Affinity purification-mass spectrometry (AP-MS):

    • Express tagged TMEM200C (FLAG, HA, or biotin) in relevant cell lines

    • Perform gentle lysis with appropriate detergents to preserve membrane protein interactions

    • Immunoprecipitate TMEM200C complexes and identify binding partners via mass spectrometry

    • Validate key interactions with reverse co-immunoprecipitation experiments

  • Proximity labeling approaches:

    • BioID: Fuse TMEM200C with a biotin ligase (BirA*) to biotinylate proximal proteins

    • APEX2: Fuse with an engineered peroxidase for rapid proximity labeling

    • These methods capture both stable and transient interactions in living cells

    • Particularly valuable for transmembrane proteins with difficult-to-preserve interactions

  • Yeast two-hybrid screening with modifications:

    • Split-ubiquitin membrane yeast two-hybrid: Specifically designed for membrane proteins

    • Cytoplasmic domain screening: Using soluble domains of TMEM200C as bait

  • Fluorescence-based interaction assays:

    • Förster Resonance Energy Transfer (FRET): For detecting direct protein interactions

    • Bimolecular Fluorescence Complementation (BiFC): To visualize interactions in living cells

    • Fluorescence Correlation Spectroscopy (FCS): For measuring binding kinetics

  • Pathway analysis approaches:

    • Phosphoproteomics: Identify changes in protein phosphorylation after TMEM200C modulation

    • Gene Set Enrichment Analysis (GSEA): Identify enriched pathways in high vs. low TMEM200C expression samples

    • Reverse Phase Protein Array (RPPA): Assess the activation status of multiple signaling pathways simultaneously

MethodAdvantagesChallengesData Analysis Approach
AP-MSComprehensive interaction mappingDetergent sensitivitySAINT or CompPASS algorithms
BioIDCaptures transient interactionsRequires 24h labelingSignificance Analysis of INTeractome
FRETReal-time in live cellsTechnical complexityAcceptor photobleaching or sensitized emission
GSEAPathway-level insightsRequires large datasetsNES scores and FDR q-values

The integration of data from multiple interaction mapping approaches provides the most comprehensive understanding of TMEM200C's functional role in cellular signaling networks.

What are the best approaches for investigating post-translational modifications of TMEM200C?

Investigating post-translational modifications (PTMs) of TMEM200C requires specialized methodologies to capture these critical regulatory mechanisms:

  • Mass spectrometry-based PTM identification:

    • Sample preparation: Immunoprecipitate TMEM200C from cells/tissues using specific antibodies

    • Enrichment strategies:

      • Phosphorylation: Titanium dioxide (TiO2) or immobilized metal affinity chromatography (IMAC)

      • Glycosylation: Lectin affinity chromatography or hydrazide chemistry

      • Ubiquitination: Antibodies against ubiquitin remnant motifs

    • MS analysis: Use high-resolution mass spectrometry with collision-induced dissociation (CID) or electron transfer dissociation (ETD)

    • Data analysis: Specialized software (MaxQuant, Proteome Discoverer) with PTM search algorithms

  • Site-directed mutagenesis validation:

    • Generate point mutations at identified PTM sites (e.g., S/T→A for phosphorylation sites)

    • Assess functional consequences through cellular assays (localization, activity, interaction)

    • Create phosphomimetic mutations (S/T→D/E) to simulate constitutive phosphorylation

  • PTM-specific detection methods:

    • Phosphorylation: Phospho-specific antibodies, Phos-tag gels, 32P labeling

    • Glycosylation: PNGase F or Endo H treatment, lectin blotting, metabolic labeling

    • Ubiquitination: Ubiquitin pulldowns, cycloheximide chase assays

  • PTM dynamics analysis:

    • Pulse-chase experiments: To measure PTM turnover rates

    • Stimulation time-courses: To capture dynamic PTM changes after pathway activation

    • Quantitative proteomics: SILAC, TMT, or label-free approaches to measure PTM stoichiometry

  • Computational prediction and analysis:

    • Use algorithms to predict potential PTM sites (NetPhos, GlycoMine, UbPred)

    • Integrate PTM data with structural models to assess functional implications

    • Compare conservation of PTM sites across species to gauge evolutionary importance

Understanding the PTM landscape of TMEM200C will provide crucial insights into its regulation and potential targeting strategies in disease contexts.

What are the optimal conditions for expressing and purifying recombinant TMEM200C protein?

Successful expression and purification of recombinant TMEM200C requires careful optimization of multiple parameters:

  • Expression system selection and optimization:

    • Mammalian cells (HEK293, CHO): Provide proper folding and post-translational modifications

      • Optimize transfection conditions (reagent, DNA:reagent ratio, cell density)

      • Consider stable cell line development for consistent production

    • Insect cells (Sf9, High Five): Balance between yield and proper folding

      • Optimize multiplicity of infection (MOI) and harvest time

    • Cell-free systems: Alternative for difficult-to-express proteins

      • Requires optimization of reaction components and conditions

  • Construct design considerations:

    • Incorporate affinity tags (His6, FLAG, Strep-tag II) for purification

    • Consider fusion partners (MBP, SUMO) to enhance solubility

    • Include protease cleavage sites for tag removal

    • Codon optimization for the expression system of choice

  • Membrane protein solubilization and purification:

    • Detergent screening: Test multiple detergents (DDM, LMNG, GDN) at various concentrations

    • Solubilization conditions: Optimize buffer composition, pH, salt concentration, and temperature

    • Purification strategy:

      • Initial capture: Immobilized metal affinity chromatography (IMAC)

      • Intermediate: Ion exchange chromatography (IEX)

      • Final polishing: Size exclusion chromatography (SEC)

  • Protein stabilization approaches:

    • Screen buffer additives (glycerol, specific lipids, cholesterol hemisuccinate)

    • Consider nanodiscs or styrene-maleic acid copolymer lipid particles (SMALPs) for native-like environment

    • Test protein stabilizing compounds specific to the protein class

  • Quality control assessments:

    • SDS-PAGE and Western blotting to confirm identity and purity

    • Circular dichroism to assess secondary structure integrity

    • Thermal shift assays to evaluate protein stability

    • Dynamic light scattering to assess homogeneity and aggregation state

The optimized protocol should be thoroughly documented to ensure reproducibility across different production batches.

How can researchers develop and validate specific antibodies against TMEM200C?

Developing specific and effective antibodies against TMEM200C requires a systematic approach:

  • Antigen design and production:

    • Peptide antigens:

      • Select hydrophilic, surface-exposed regions (15-20 amino acids)

      • Avoid transmembrane domains and highly conserved regions

      • Consider multiple peptides targeting different epitopes

    • Recombinant protein fragments:

      • Express extracellular or intracellular domains

      • Ensure proper folding and purification

    • DNA immunization:

      • Use expression vectors encoding full-length or partial TMEM200C

  • Immunization strategy:

    • Animal selection: Rabbits for polyclonal antibodies; mice or rats for monoclonal antibodies

    • Adjuvant selection: Complete/incomplete Freund's, alum, or proprietary adjuvants

    • Immunization schedule: Prime-boost regimen with appropriate intervals

    • Monitoring: ELISA testing of serum titers to track immune response

  • Antibody production methods:

    • Polyclonal antibodies:

      • Collection and purification from serum

      • Affinity purification against immunizing antigen

    • Monoclonal antibodies:

      • Hybridoma technology or recombinant antibody generation

      • Screening and selection of positive clones

      • Subcloning to ensure monoclonality

  • Validation methods (critical for ensuring specificity):

    • Western blotting:

      • Test on cells with endogenous, overexpressed, and knocked-down TMEM200C

      • Include appropriate positive and negative controls

    • Immunoprecipitation: Verify ability to pull down TMEM200C

    • Immunofluorescence: Confirm expected subcellular localization

    • Flow cytometry: For cell surface expression analysis

    • Immunohistochemistry: Validate on tissue microarrays with known expression patterns

    • Knockout/knockdown controls: Essential to confirm specificity

  • Characterization parameters:

    • Determine optimal working dilutions for different applications

    • Test cross-reactivity with other TMEM family members

    • Assess lot-to-lot consistency for reproducibility

What are the best imaging techniques for visualizing TMEM200C localization in cells and tissues?

Visualizing TMEM200C localization requires specialized imaging approaches optimized for membrane proteins:

  • Immunofluorescence microscopy:

    • Sample preparation:

      • Fixation: Test multiple fixatives (4% PFA, methanol) as they affect epitope accessibility

      • Permeabilization: Optimize detergent type and concentration (Triton X-100, saponin)

      • Antigen retrieval: May be necessary for formalin-fixed tissues

    • Imaging approaches:

      • Widefield: For initial localization studies

      • Confocal: For improved resolution and colocalization analysis

      • Super-resolution (STED, STORM, PALM): For nanoscale distribution analysis

  • Live-cell imaging with fluorescent protein tags:

    • Tag placement: N- or C-terminal fusion based on protein topology

    • Tag selection: mEGFP, mCherry, or photoactivatable fluorescent proteins

    • Validation: Confirm functionality of tagged protein

    • Applications: Trafficking studies, FRAP for mobility assessment, pulse-chase for turnover

  • Proximity ligation assay (PLA):

    • Detect protein-protein interactions with spatial resolution

    • Requires two primary antibodies (anti-TMEM200C and anti-interacting protein)

    • Provides single-molecule sensitivity for low-abundance interactions

  • Electron microscopy approaches:

    • Immunogold EM: Ultra-high resolution localization in cellular compartments

    • Cryo-electron microscopy: For structural studies at near-atomic resolution

    • Correlative light and electron microscopy (CLEM): Combining fluorescence specificity with EM resolution

  • Tissue imaging considerations:

    • Multiplex immunohistochemistry: For colocalization with multiple markers

    • Tissue clearing techniques: For 3D visualization in intact tissues

    • Laser capture microdissection: For region-specific expression analysis

Imaging TechniqueResolutionAdvantagesLimitationsBest Application
Confocal microscopy~200 nmWidely available, 3D imagingLimited resolutionColocalization studies
STED microscopy~30-70 nmLive cell compatiblePhototoxicityNanodomain organization
Single-molecule localization~10-20 nmHighest resolutionComplex sample prepMolecular clustering analysis
Immunogold EM~1-5 nmUltrastructural contextFixed samples onlyPrecise subcellular localization

Selecting the appropriate imaging technique depends on the specific research question regarding TMEM200C localization and dynamics.

How should researchers approach TMEM200C expression analysis in clinical samples?

Analyzing TMEM200C expression in clinical samples requires careful methodological considerations to ensure reliable and reproducible results:

  • Sample collection and processing:

    • Fresh tissue: Immediate processing or snap-freezing to preserve RNA/protein integrity

    • FFPE samples: Consider RNA degradation and protein crosslinking effects

    • Tissue microarrays (TMAs): Enable high-throughput analysis across multiple samples

    • Standardization: Document collection protocols, ischemia time, and processing steps

  • mRNA expression analysis:

    • RT-qPCR:

      • Reference gene selection crucial for normalization

      • Consider using multiple reference genes validated for the tissue type

      • Follow MIQE guidelines for experimental reporting

    • In situ hybridization:

      • RNAscope or BaseScope for single-molecule detection

      • Provides spatial context while maintaining sensitivity

    • RNA-seq:

      • Consider protocol modifications for FFPE samples if needed

      • Quality control metrics (RIN values) should be reported

      • Account for batch effects in multi-cohort analyses

  • Protein expression analysis:

    • Immunohistochemistry (IHC):

      • Use validated antibodies with appropriate controls

      • Standardize staining protocols across batches

      • Implement quantitative scoring systems (H-score, Allred)

      • Consider automated image analysis for consistency

    • Western blotting:

      • Protein extraction from clinical samples requires optimization

      • Include loading controls appropriate for the sample type

    • Proteomics approaches:

      • Consider laser microdissection to enrich for specific regions

  • Data analysis and interpretation:

    • Statistical methods:

      • Non-parametric tests often appropriate for clinical data

      • Account for multiple hypothesis testing

      • Control for clinicopathological variables

    • Correlation analyses:

      • With clinical outcomes (survival, treatment response)

      • With other molecular markers (multivariate models)

    • Visualization approaches:

      • Kaplan-Meier curves for survival analyses

      • Forest plots for hazard ratios

  • Reporting standards:

    • Follow REMARK guidelines for prognostic marker studies

    • Clearly document antibody validation, scoring methods, and cutoff determination

    • Report positive and negative controls used

A systematic approach to clinical sample analysis ensures that findings related to TMEM200C expression have translational relevance and reproducibility across different patient cohorts.

How should researchers interpret contradictory data regarding TMEM200C expression across different cancer types?

When faced with contradictory findings regarding TMEM200C expression across cancer types, researchers should implement a systematic approach to reconcile and interpret these differences:

  • Critical assessment of methodological differences:

    • Sample types: Compare fresh-frozen versus FFPE tissues

    • Detection methods: RNA-seq versus microarray versus RT-qPCR

    • Antibody specificity: Different antibodies may recognize different epitopes or isoforms

    • Quantification approaches: Absolute versus relative quantification

  • Biological context considerations:

    • Cancer heterogeneity: Different molecular subtypes within the same cancer may show variable expression

    • Tumor microenvironment: Stromal or immune cell infiltration may confound bulk tumor measurements

    • Disease stage: Expression may change during progression (early versus advanced disease)

    • Treatment effects: Prior therapy may alter expression patterns

  • Systematic meta-analysis approach:

    • Statistical methods:

      • Random-effects models to account for inter-study heterogeneity

      • Subgroup analyses by cancer type, detection method, and patient population

      • Publication bias assessment using funnel plots and Egger's test

    • Standardization: Convert different expression metrics to effect sizes for comparison

    • Heterogeneity quantification: I² statistic to measure inconsistency across studies

  • Validation strategies:

    • Single-cell RNA-seq: To resolve cell type-specific expression patterns

    • Multi-omics integration: Correlate mRNA with protein expression and functional data

    • Independent cohort validation: Test findings in additional patient populations

  • Biological validation of cancer-specific functions:

    • Cancer-specific cell line panels: Test functional effects across diverse cancer models

    • Pathway context: Determine if TMEM200C interacts with different partners in different cancers

    • Genetic background: Consider how driver mutations might influence TMEM200C function

When reporting seemingly contradictory findings, researchers should clearly acknowledge limitations, potential sources of variability, and propose testable hypotheses to explain observed differences across cancer types.

What bioinformatics tools and databases are most useful for analyzing TMEM200C expression and function?

Researchers investigating TMEM200C should leverage these specialized bioinformatics resources:

  • Gene expression databases and analysis tools:

    • The Cancer Genome Atlas (TCGA): Comprehensive cancer genomics data

    • Gene Expression Omnibus (GEO): Repository of high-throughput gene expression data

    • cBioPortal: Interactive exploration of cancer genomics datasets

    • GEPIA2: Gene Expression Profiling Interactive Analysis for TCGA and GTEx data

    • UALCAN: User-friendly portal for gene expression analysis in cancer

    • R Bioconductor packages: DESeq2, edgeR, limma for differential expression analysis

  • Protein structure and function prediction:

    • AlphaFold/RoseTTAFold: State-of-the-art protein structure prediction

    • TMHMM/TOPCONS: Transmembrane topology prediction

    • SignalP: Signal peptide prediction

    • NetNGlyc/NetOGlyc: Glycosylation site prediction

    • GPS: Phosphorylation and other PTM site prediction

  • Pathway and network analysis tools:

    • GSEA: Gene Set Enrichment Analysis for pathway identification

    • Enrichr: Gene list enrichment analysis tool

    • STRING: Protein-protein interaction networks

    • Cytoscape: Network visualization and analysis

    • Reactome/KEGG: Pathway databases and visualization tools

  • Single-cell analysis resources:

    • Seurat/Scanpy: R and Python packages for scRNA-seq analysis

    • Single Cell Portal: Interface for exploring single-cell datasets

    • CellMarker: Database of cell type-specific markers

    • scRNA-seq datasets: Human Cell Atlas, COVID-19 Cell Atlas

  • Clinical correlation and survival analysis:

    • KM plotter: Survival analysis across multiple cancer types

    • SurvExpress: Gene expression-based survival analysis

    • survminer/survival: R packages for survival analysis

    • TIMER2.0: Tool for comprehensive analysis of tumor-infiltrating immune cells

Analysis TypeRecommended ToolsData Input FormatKey Output Metrics
Expression analysisDESeq2, GEPIA2Count matrices, FPKM/TPMLog2 fold change, P-values, FDR
Survival analysisKM plotter, survminerExpression + clinical dataHazard ratios, P-values, survival curves
Pathway analysisGSEA, EnrichrRanked gene listEnrichment scores, FDR q-values
Structure predictionAlphaFold, TMHMMProtein sequence3D models, topology predictions

These computational resources provide a comprehensive toolkit for investigating TMEM200C from sequence to clinical relevance, enabling data-driven hypothesis generation and experimental design.

How can researchers effectively integrate multi-omics data to understand TMEM200C's role in cancer?

Integrating multi-omics data provides a comprehensive view of TMEM200C's role in cancer. Researchers should implement this systematic framework:

  • Data collection and preprocessing:

    • Genomics: Copy number alterations, mutations affecting TMEM200C

    • Transcriptomics: mRNA expression (bulk and single-cell)

    • Proteomics: Protein expression, post-translational modifications

    • Epigenomics: Methylation status, chromatin accessibility, histone modifications

    • Metabolomics: Metabolic changes associated with TMEM200C expression

    • Clinical data: Patient outcomes, treatment responses

  • Integration methodologies:

    • Correlation-based approaches:

      • Pearson/Spearman correlations across data types

      • Weighted gene co-expression network analysis (WGCNA)

    • Dimensionality reduction techniques:

      • Multi-omics factor analysis (MOFA)

      • Joint and individual variation explained (JIVE)

      • Canonical correlation analysis (CCA)

    • Network-based integration:

      • Similarity network fusion (SNF)

      • Multiplex networks combining different data types

    • Machine learning approaches:

      • Multi-view clustering

      • Transfer learning across data modalities

  • Functional interpretation frameworks:

    • Pathway enrichment across multi-omics layers:

      • Identify pathways consistently altered across data types

      • Pathway-based integration using iPAS or PathMe

    • Causal network reconstruction:

      • Bayesian networks to infer relationships between omics layers

      • Infer potential regulatory mechanisms affecting TMEM200C

    • Visualization strategies:

      • Circos plots for multi-omics data visualization

      • Heatmaps with multiple annotation tracks

  • Validation approaches:

    • In silico validation:

      • Cross-validation across independent datasets

      • Bootstrapping to assess finding robustness

    • Experimental validation:

      • Targeted experiments to test computationally derived hypotheses

      • Systematic perturbation experiments (CRISPR screens)

  • Integration with public knowledge:

    • Map findings to known cancer pathways and hallmarks

    • Connect TMEM200C networks to drug target databases for therapeutic insights

    • Compare with other TMEM family proteins for functional patterns

The integration of multiple data types provides a systems-level understanding of TMEM200C's role in cancer, revealing potential mechanisms that might not be apparent from any single data type alone.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.