Recombinant Human Transmembrane protein 201 (TMEM201)

Shipped with Ice Packs
In Stock

Description

Molecular Overview of TMEM201

TMEM201 is an inner nuclear membrane (INM) protein encoded by the TMEM201 gene (Gene ID: 199953) in humans. Key features include:

  • Aliases: NET5, SAMP1, Ima1 .

  • Structure: Contains an N-terminal domain with conserved CxxC motifs for zinc finger formation and a nucleocytoplasmic C-terminal domain .

  • Function:

    • Regulates nuclear movement via actin-dependent mechanisms .

    • Interacts with the LINC (LInker of Nucleoskeleton and Cytoskeleton) complex to mediate mechanical force transmission .

    • Modulates endothelial cell (EC) migration and angiogenesis .

Role in Cell Migration and Angiogenesis

  • Endothelial Cell Behavior:

    • TMEM201 knockdown in human umbilical vein endothelial cells (HUVECs) reduced tube formation by >50% and impaired sprouting in fibrin gel assays .

    • Loss of TMEM201 delayed retinal vascular plexus development in Tmem201-knockout mice .

Mechanism of Action

  • LINC Complex Interaction:

    • The N-terminal domain binds SUN1/SUN2 and Emerin, facilitating actin-dependent nuclear movement .

    • Truncation experiments confirmed the N-terminus is critical for EC migration and angiogenesis .

Disease Relevance

  • Cancer Metastasis:

    • Overexpression promotes breast cancer cell invasion via SMAD2/3 phosphorylation and TGF-β signaling .

    • Isoform SAMP1 enhances migration in HUVECs, suggesting conserved roles across isoforms .

Applications in Research

Recombinant TMEM201 is utilized to:

  1. Investigate nuclear-cytoskeletal coupling mechanisms .

  2. Develop inhibitors targeting TMEM201-LINC interactions for cancer therapy .

  3. Study angiogenesis defects in in vitro models (e.g., EC sprouting assays) .

Challenges and Future Directions

  • Structural Insights: The C-terminal domain’s function remains poorly understood .

  • Therapeutic Potential: Targeting TMEM201 could mitigate pathological angiogenesis or metastasis, but in vivo efficacy requires validation .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order remarks. We will fulfill your requests as much as possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please contact us in advance for additional fees.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, aliquots can be stored at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by multiple factors including storage conditions, buffer composition, temperature, and protein stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us and we will prioritize its development.
Synonyms
TMEM201; NET5; SAMP1; Transmembrane protein 201; Spindle-associated membrane protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-666
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
TMEM201
Target Protein Sequence
MEGVSALLARCPTAGLAGGLGVTACAAAGVLLYRIARRMKPTHTMVNCWFCNQDTLVPYG NRNCWDCPHCEQYNGFQENGDYNKPIPAQYLEHLNHVVSSAPSLRDPSQPQQWVSSQVLL CKRCNHHQTTKIKQLAAFAPREEGRYDEEVEVYRHHLEQMYKLCRPCQAAVEYYIKHQNR QLRALLLSHQFKRREADQTHAQNFSSAVKSPVQVILLRALAFLACAFLLTTALYGASGHF APGTTVPLALPPGGNGSATPDNGTTPGAEGWRQLLGLLPEHMAEKLCEAWAFGQSHQTGV VALGLLTCLLAMLLAGRIRLRRIDAFCTCLWALLLGLHLAEQHLQAASPSWLDTLKFSTT SLCCLVGFTAAVATRKATGPRRFRPRRFFPGDSAGLFPTSPSLAIPHPSVGGSPASLFIP SPPSFLPLANQQLFRSPRRTSPSSLPGRLSRALSLGTIPSLTRADSGYLFSGSRPPSQVS RSGEFPVSDYFSLLSGSCPSSPLPSPAPSVAGSVASSSGSLRHRRPLISPARLNLKGQKL LLFPSPPGEAPTTPSSSDEHSPHNGSLFTMEPPHVPRKPPLQDVKHALDLRSKLERGSAC SNRSIKKEDDSSQSSTCVVDTTTRGCSEEAATWRGRFGPSLVRGLLAVSLAANALFTSVF LYQSLR
Uniprot No.

Target Background

Function
TMEM201 plays a crucial role in nuclear movement during fibroblast polarization and migration. It is believed to be involved in actin-dependent nuclear movement through association with transmembrane actin-associated nuclear (TAN) lines. These lines are bound to F-actin cables and couple the nucleus to retrograde actin flow. Overexpression of TMEM201 can recruit Ran GTPase to the nuclear periphery. TMEM201 might define a distinct membrane domain in the vicinity of the mitotic spindle. It is involved in the organization of the nuclear envelope, implicating its interaction with Emerin (EMD), SUN1, and A-type lamina.
Gene References Into Functions
  1. Studies have shown that the mobility of YFP-Emerin was increased in Samp1 knockout cells and decreased in cells overexpressing Samp1. This suggests that Samp1 significantly attenuates the mobility of Emerin within the nuclear envelope. Furthermore, the affinity between Samp1 and Emerin is reduced in the presence of Ran, indicating that Ran weakens the interaction between Samp1 and Emerin. PMID: 29510091
  2. Samp1 is implicated in the early differentiation of induced pluripotent stem cells. PMID: 28668644
  3. Research has demonstrated that the nucleoplasmic domains of Samp1 and Emerin can bind directly to each other. PMID: 24950247
  4. A transmembrane protein of the nuclear envelope, named spindle-associated membrane protein 1 (Samp1), has been characterized. Samp1 defines a specific membrane domain associated with the mitotic spindle. PMID: 19494128
Database Links

HGNC: 33719

KEGG: hsa:199953

STRING: 9606.ENSP00000344503

UniGene: Hs.632365

Subcellular Location
[Isoform 2]: Nucleus inner membrane; Multi-pass membrane protein. Cytoplasm, cytoskeleton, spindle pole.

Q&A

What is TMEM201 and where is it localized within cells?

TMEM201 is an inner nuclear membrane (INM) protein that forms part of the nuclear envelope complex. The nuclear envelope comprises the outer nuclear membrane, inner nuclear membrane, and nucleopore. TMEM201 is specifically localized to the inner nuclear membrane, with its structure featuring five predicted transmembrane segments (TMSs). The protein's topology includes both N-terminus and C-terminus (before the last TMS) exposed in the nucleoplasm, which is critical for its functional interactions .

What is the primary function of TMEM201 in cellular processes?

TMEM201 plays a crucial role in regulating endothelial cell migration and controlling the process of angiogenesis. Research has demonstrated that TMEM201 positively modulates the invasion and migration of cells, with its depletion resulting in impaired migration capabilities. Additionally, TMEM201 participates in establishing endothelial cell polarity during directional migration. Mechanistically, TMEM201 interacts with the linker of nucleoskeleton and cytoskeleton (LINC) complex, which is essential for coordinated cell movement .

How does TMEM201 contribute to angiogenesis?

TMEM201 is a positive regulator of angiogenesis, the process of new blood vessel formation. When TMEM201 expression is depleted in human umbilical vein endothelial cells (HUVECs), their angiogenic behavior is significantly impeded, with reduced tube formation capacity (>50% fewer junctions and branches compared to control groups). Additionally, TMEM201 knockdown results in decreased number and length of endothelial cell sprouts in fibrin gel bead sprouting assays. Competitive sprouting assays further confirm that TMEM201 expression positively correlates with endothelial cell sprouting ability .

What in vitro models are most effective for studying TMEM201 function?

For studying TMEM201 function in vitro, human umbilical vein endothelial cells (HUVECs) and the endothelial cell line EA.hy926 have proven to be effective models. These cell types allow for various functional assays, including:

  • Tube formation assays to assess angiogenic behavior

  • Fibrin gel bead sprouting assays to evaluate sprouting angiogenesis

  • Transwell migration assays to quantify cell migration

  • Wound healing assays to study directional migration

  • Cell polarity assessments (Golgi apparatus orientation)

Additionally, competitive sprouting assays using differentially labeled cells (expressing control or TMEM201-knockdown constructs) provide a powerful approach to directly compare the effects of TMEM201 depletion within the same experimental environment .

What are the available in vivo models for investigating TMEM201 function?

Two primary in vivo models have been validated for studying TMEM201 function:

  • Tmem201-knockout mice: These models show arrested retinal vessel development and defective aortic ring sprouting, confirming the protein's role in angiogenesis.

  • Zebrafish models: Loss of tmem201 in zebrafish impairs intersegmental vessel development, providing another vertebrate model system to study TMEM201's role in vascular development .

These complementary models allow researchers to verify in vitro findings in physiologically relevant contexts and explore developmental aspects of TMEM201 function.

What methodologies are recommended for TMEM201 gene silencing studies?

Short hairpin RNA (shRNA)-mediated gene silencing has been successfully applied to study TMEM201 function. The approach involves:

  • Design of shRNAs specifically targeting different regions of TMEM201 mRNA

  • Validation of knockdown efficiency through immunoblotting and RT-qPCR

  • Functional assays to assess phenotypic changes

Research shows that effective TMEM201 knockdown can be achieved with multiple shRNA constructs (e.g., TMEM201-shRNA-1# and TMEM201-shRNA-2#), reducing the risk of off-target effects by allowing comparison between different constructs .

shRNA ConstructTarget RegionValidation MethodKnockdown Efficiency
TMEM201-shRNA-1#Region 1 of TMEM201 mRNAImmunoblotting, RT-qPCR>50% reduction in expression
TMEM201-shRNA-2#Region 2 of TMEM201 mRNAImmunoblotting, RT-qPCR>50% reduction in expression

How does TMEM201 interact with the LINC complex?

TMEM201 directly interacts with components of the linker of nucleoskeleton and cytoskeleton (LINC) complex, which is critical for its function in cell migration. Specific interaction patterns include:

  • Interaction with SUN1/2: Co-immunoprecipitation (CoIP) assays have confirmed direct interaction between TMEM201 and SUN1/2 proteins, core components of the LINC complex.

  • Interaction with LaminA/C: TMEM201 also interacts with LaminA/C, a key component of the nuclear lamina.

These interactions have been verified through both immunofluorescence confocal studies and various CoIP assays. The N-terminus of TMEM201, which is exposed in the nucleoplasm, is particularly important for these interactions .

What domains of TMEM201 are critical for its function in endothelial cells?

The N-terminal domain of TMEM201 is essential for its function in endothelial cells. This domain:

  • Interacts directly with the LINC complex components

  • Is required for regulating endothelial cell migration

  • Is exposed in the nucleoplasm, facilitating its interactions with nuclear proteins

The predicted topology of TMEM201 includes five transmembrane segments, with both the N-terminus and C-terminus (before the last TMS) exposed in the nucleoplasm. This structural arrangement allows for functional interactions with nuclear components involved in cell migration and angiogenesis .

What methods are recommended for producing recombinant human TMEM201 for research applications?

While the search results don't specifically address recombinant TMEM201 production, based on similar nuclear membrane protein production protocols, researchers can consider:

  • Expression System Selection: E. coli-based expression systems can be used for producing segments of TMEM201, particularly the soluble N-terminal domain. For full-length protein with proper folding and post-translational modifications, mammalian or insect cell expression systems are recommended.

  • Purification Approach: For membrane proteins like TMEM201, detergent-based extraction followed by affinity chromatography (using tags such as His or FLAG) is typically effective. Size exclusion chromatography can be used as a final purification step.

  • Protein Stabilization: Addition of carrier proteins (like BSA) or appropriate detergents can enhance stability of the recombinant protein, similar to approaches used with other recombinant proteins .

How can researchers verify the functional activity of recombinant TMEM201?

Functional validation of recombinant TMEM201 can be performed through several complementary approaches:

  • Binding Assays: Co-immunoprecipitation or pull-down assays to verify interaction with known binding partners like SUN1/2 and LaminA/C

  • Cell-Based Rescue Experiments: Introduction of recombinant TMEM201 into TMEM201-knockdown cells to assess rescue of migration and angiogenic phenotypes

  • Structural Integrity Assessment: Circular dichroism or limited proteolysis to confirm proper folding

  • Subcellular Localization: Immunofluorescence studies to verify proper targeting to the inner nuclear membrane when introduced into cells

What are the research implications of TMEM201's role in endothelial cell migration for disease models?

The discovery that TMEM201 regulates endothelial cell migration and angiogenesis has significant implications for various disease models:

  • Cancer Research: Since TMEM201 positively modulates cell invasion, migration, and angiogenesis (all crucial for tumor development), it may represent a potential target for anti-angiogenic cancer therapies.

  • Vascular Disorders: The role of TMEM201 in retinal vessel development and aortic ring sprouting suggests its potential involvement in vascular developmental disorders.

  • Wound Healing: The positive effect of TMEM201 on cell migration and angiogenesis indicates it may play a role in wound healing processes.

  • Inflammatory Conditions: Given the importance of angiogenesis in inflammatory responses, TMEM201 may be relevant to inflammatory disease models .

What controls should be included when studying TMEM201 knockdown effects?

When investigating TMEM201 knockdown effects, the following controls are essential:

  • Scrambled shRNA Control: Use of a non-targeting shRNA with the same vector backbone to account for effects of the delivery method.

  • Multiple shRNA Constructs: Utilization of at least two different shRNA sequences targeting TMEM201 to distinguish specific effects from off-target effects.

  • Rescue Experiments: Re-introduction of shRNA-resistant TMEM201 to confirm that observed phenotypes are specifically due to TMEM201 depletion.

  • Positive Controls: Including known regulators of endothelial cell migration or angiogenesis as positive controls for functional assays.

  • Fluorescence Tag Controls: When using fluorescently tagged constructs, switching the fluorescent proteins between control and experimental conditions to exclude tag-specific effects, as demonstrated in the competitive sprouting assays .

How can researchers distinguish between TMEM201's direct effects on migration versus indirect effects on cell proliferation?

To differentiate between direct effects on migration and indirect effects on proliferation:

  • Short-Duration Assays: Use shorter-term assays like wound healing (e.g., 8 hours) to minimize the influence of proliferation differences.

  • Proliferation Controls: Perform parallel proliferation assays to quantify and account for any differences in cell growth rates.

  • Cell Cycle Inhibitors: Use of cell cycle inhibitors in migration assays can help isolate migration effects from proliferation effects.

  • Live Cell Imaging: Track individual cell movements to directly measure migration parameters independent of cell number increases .

What experimental considerations should be made when analyzing TMEM201's interaction with the LINC complex?

When analyzing TMEM201's interaction with the LINC complex, researchers should consider:

  • Reciprocal Co-IP Experiments: Perform immunoprecipitation in both directions (i.e., pull down TMEM201 and probe for LINC components, and vice versa) to confirm specific interactions.

  • Negative Controls: Include negative control proteins that are not expected to interact with either TMEM201 or LINC components.

  • Domain Mapping: Use truncated versions of TMEM201 to map the specific domains involved in the interaction.

  • Proximity Ligation Assays: Consider using these to visualize and quantify protein-protein interactions in situ.

  • Detergent Conditions: Carefully optimize detergent conditions for membrane protein extraction to maintain native interactions while effectively solubilizing the proteins .

What are the potential roles of TMEM201 in pathological angiogenesis beyond current research findings?

While current research establishes TMEM201's role in developmental angiogenesis, several promising research directions for pathological angiogenesis include:

  • Tumor Angiogenesis: Investigating TMEM201 expression levels in tumor vasculature and their correlation with tumor progression and metastasis.

  • Ischemic Diseases: Examining whether TMEM201 manipulation could enhance therapeutic angiogenesis in models of ischemic heart disease or stroke.

  • Retinopathies: Given TMEM201's role in retinal vessel development, exploring its involvement in diabetic retinopathy or age-related macular degeneration.

  • Inflammatory Angiogenesis: Studying TMEM201's potential role in inflammatory conditions with aberrant angiogenesis, such as rheumatoid arthritis or psoriasis .

How might post-translational modifications regulate TMEM201 function?

While the search results don't directly address post-translational modifications of TMEM201, this represents an important area for future research:

  • Phosphorylation: Investigating whether TMEM201 is phosphorylated in response to angiogenic signals and how this might regulate its interactions with the LINC complex.

  • Ubiquitination: Studying if TMEM201 stability and turnover are regulated by the ubiquitin-proteasome system.

  • Glycosylation: Examining potential glycosylation sites and their impact on TMEM201 localization and function.

  • SUMOylation: Exploring whether TMEM201, like other nuclear proteins, undergoes SUMOylation that affects its nuclear interactions .

What high-throughput approaches could accelerate TMEM201 research?

Several high-throughput approaches could significantly advance TMEM201 research:

  • Interactome Analysis: Mass spectrometry-based proteomics to comprehensively identify TMEM201 binding partners under various conditions.

  • CRISPR Screens: Genome-wide CRISPR screens to identify genes that synthetically interact with TMEM201 or modify phenotypes associated with TMEM201 manipulation.

  • Transcriptomics: RNA-seq analysis of TMEM201-deficient cells to identify downstream pathways affected by TMEM201 loss.

  • Small Molecule Screens: High-throughput screening to identify compounds that modulate TMEM201 expression or function, potentially yielding tools for further research or therapeutic development.

  • Single-cell Analysis: Single-cell approaches to understand the heterogeneity of TMEM201 expression and function in complex tissues like tumor vasculature .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.