Recombinant Human Transmembrane protein 205 (TMEM205)

Shipped with Ice Packs
In Stock

Description

Platinum-Drug Resistance

TMEM205 mediates resistance to cisplatin and oxaliplatin by extruding these drugs from cells via a sulfur-based translocation mechanism. Key findings include:

  • Selective Transport: Recombinant TMEM205-expressing cells show reduced intracellular cisplatin and oxaliplatin levels but no effect on carboplatin .

  • Mechanistic Insight: Conserved cysteine (Cys-53) and methionine (Met-56) residues in transmembrane domains are critical for Pt(II)-drug recognition and export .

Immune Modulation

In hepatocellular carcinoma (HCC), TMEM205 expression correlates with:

  • Reduced M2 macrophage polarization (CD163, EGR2) and regulatory T-cell infiltration (CCR8, STAT5B) .

  • Increased CD8+ T-cell infiltration (Pearson r = 0.26, p < 0.0001), suggesting immune microenvironment remodeling .

Research Applications

Recombinant TMEM205 is utilized in:

  • Drug Resistance Assays: Quantifying Pt(II)-drug extrusion using cellular growth and filamentation metrics in E. coli models .

  • Therapeutic Target Screening: Identifying inhibitors to counteract cisplatin resistance in cancers like ovarian clear cell carcinoma .

  • Diagnostic Tools: ELISA kits (e.g., MBS9317586) employ recombinant TMEM205 to detect endogenous protein levels in clinical samples .

Cisplatin Resistance

  • TMEM205 overexpression in gastric cancer (GC) activates Wnt/β-catenin signaling, promoting proliferation, stemness, and epithelial–mesenchymal transition (EMT) .

  • Nuclear translocation of TMEM205 in resistant cells enhances drug efflux via RAB8 interaction .

Prognostic Biomarker

  • In HCC, high TMEM205 expression correlates with improved survival (HR = 0.64, p = 0.019) and reduced immunosuppressive cell infiltration .

Key Research Findings

StudyModelKey Result
Rosenberg Group (2020)E. coli expressionTMEM205 selectively exports cisplatin/oxaliplatin via Cys/Met residues .
Shen et al. (2024)Gastric cancerTMEM205 drives cisplatin resistance via Wnt/β-catenin and TAM/M2 polarization .
Bueno et al. (2015)Post-transplant kidneyTMEM205 linked to immune response pathways .

Future Directions

  • Therapeutic Targeting: Small-molecule inhibitors of TMEM205 could enhance cisplatin efficacy in resistant tumors .

  • Immune Combination Therapies: Pairing TMEM205 modulation with checkpoint inhibitors may improve HCC outcomes .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have a specific format requirement, please indicate it when placing your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by multiple factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
TMEM205; UNQ501/PRO1018; Transmembrane protein 205
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-189
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
TMEM205
Target Protein Sequence
MEEGGNLGGLIKMVHLLVLSGAWGMQMWVTFVSGFLLFRSLPRHTFGLVQSKLFPFYFHI SMGCAFINLCILASQHAWAQLTFWEASQLYLLFLSLTLATVNARWLEPRTTAAMWALQTV EKERGLGGEVPGSHQGPDPYRQLREKDPKYSALRQNFFRYHGLSSLCNLGCVLSNGLCLA GLALEIRSL
Uniprot No.

Target Background

Function
In cancer cells, TMEM205 plays a role in resistance to the chemotherapeutic agent cisplatin.
Gene References Into Functions
  1. Genetic polymorphisms in OCT2, AQP2, AQP9, and TMEM205 may contribute to chemotherapy response in lung cancer patients. PMID: 24643204
  2. Research indicates that a novel mechanism for cisplatin resistance is mediated by TMEM205 overexpression. PMID: 20589834
Database Links

HGNC: 29631

OMIM: 613771

KEGG: hsa:374882

STRING: 9606.ENSP00000346954

UniGene: Hs.737060

Protein Families
TMEM205 family
Subcellular Location
Membrane; Multi-pass membrane protein. Note=Located on cell surface microvilli. In cancer cells, transition in subcellular location from cell surface to intracellular regions correlates the progression of cisplatin resistance.
Tissue Specificity
Widely expressed with highest levels in pancreas, followed by adrenal gland, thyroid, liver, mammary gland, prostate, kidney, and retina; lowest levels in skeletal muscle. Overexpressed in cisplatin-resistant cancer cells (at protein level).

Q&A

What is TMEM205 and what is its cellular localization?

TMEM205 is a human transmembrane protein that was first detected by functional cloning from a retroviral cDNA library made from human cisplatin-resistant cells. Using polyclonal antibodies, researchers have demonstrated that this protein is primarily localized at the cell surface. While initially characterized as a hypothetical membrane protein, subsequent research has confirmed its existence and functional importance . Immunoblotting, confocal examination, and immuno-electron microscopy techniques have all been employed to verify its cellular localization and expression patterns in various cell types.

How is TMEM205 expression regulated in normal versus cancer tissues?

TMEM205 shows significant differential expression between normal and tumor tissues. For instance, in hepatocellular carcinoma (HCC), t-test analysis of TCGA RNA-seq datasets revealed statistically significant differences in TMEM205 expression between paired tumor and normal tissues (p < 0.001) . This differential expression has been validated across multiple cancer databases, including both TCGA and ICGC cohorts. Expression is typically measured using RT-PCR techniques with TaqMan Gene Expression Assays, where TMEM205 crossing point values are normalized to reference genes such as GAPDH .

What is the connection between TMEM205 and cisplatin resistance?

TMEM205 plays a significant role in mediating cisplatin resistance in cancer cells. The development of cisplatin resistance has been associated with reduced accumulation of cisplatin in resistant cells, and TMEM205 contributes to this phenomenon . Specifically, TMEM205 mediates resistance to platinum compounds by facilitating drug extrusion from cells, thereby reducing intracellular platinum concentration and cytotoxicity . This resistance mechanism has been documented through both overexpression studies and functional assays measuring intracellular platinum content in cells with varying TMEM205 expression levels.

What is the molecular mechanism by which TMEM205 mediates platinum drug resistance?

TMEM205 appears to mediate platinum drug resistance through selective extrusion of certain platinum compounds. Research has demonstrated that TMEM205 functions selectively towards cisplatin and oxaliplatin but not carboplatin . Mutation analysis suggests that TMEM205 recognizes and facilitates platinum drug extrusion through a putative sulfur-based translocation mechanism. Additionally, TMEM205 can undergo nuclear translocation in cisplatin-resistant cells and interact with RAB8 to promote the accumulation of cisplatin outside the cell, further enhancing resistance . This selective mechanism represents a form of pre-target resistance that limits drug efficacy by preventing platinum compounds from reaching their intracellular targets.

What is the relationship between TMEM205, the tumor microenvironment, and immune cell populations?

TMEM205 expression significantly correlates with the composition of the tumor microenvironment (TME). Specifically, TMEM205 expression shows a strong positive correlation with the proportion of macrophages in tumor tissues (Pearson r = 0.45, p < 0.0001) . Furthermore, TMEM205 expression appears to influence the polarization of macrophages, showing negative correlations with M2 macrophage markers (CD163, EGR2, and MS4A4A) . TMEM205 also negatively correlates with chemokine receptors CCR4 and CCR5, which are responsible for regulatory T cell (Treg) migration to the TME, as well as with Treg markers (CCR8, STAT5B, and IL2RA) . These findings suggest TMEM205 may inhibit M2 macrophage polarization, inhibit Treg recruitment, and facilitate CD8+ T cell infiltration into tumor tissues, potentially explaining its association with improved patient prognosis.

How can recombinant TMEM205 be effectively expressed and purified for functional studies?

For recombinant expression of TMEM205, researchers have developed a low-cost and high-throughput platform coupled to in vivo functional resistance assays . This system typically involves:

  • Cloning the TMEM205 cDNA into appropriate expression vectors

  • Transformation into expression hosts (typically E. coli systems for initial characterization)

  • Induction of protein expression under optimized conditions

  • Membrane protein extraction using detergent solubilization

  • Purification via affinity chromatography and size exclusion methods

This platform allows for both protein production and functional characterization in a unified system, making it particularly valuable for structure-function studies of membrane proteins like TMEM205.

What techniques are most effective for measuring TMEM205-mediated platinum drug extrusion?

Several complementary approaches can be used to measure TMEM205-mediated platinum drug extrusion:

  • Quantitative Platinum Analysis: Inductively coupled plasma mass spectrometry (ICP-MS) to precisely measure intracellular platinum concentrations in control versus TMEM205-expressing cells after cisplatin exposure.

  • Fluorescence-Labeled Cisplatin Tracking: Monitoring the accumulation and efflux of fluorescently-labeled cisplatin analogs in real-time via confocal microscopy.

  • Cell Growth and Filamentation Assays: Quantitative analysis of the effects of platinum compounds on cellular growth and filamentation in E. coli cells expressing TMEM205, which provides a convenient system for high-throughput screening .

  • Membrane Vesicle Transport Assays: Inside-out membrane vesicles from TMEM205-expressing cells to directly measure ATP-dependent platinum drug transport.

These methods, particularly when used in combination, provide robust assessment of TMEM205's drug extrusion capability.

How should TMEM205 expression be quantified in clinical tumor samples?

For clinical tumor samples, several methods are recommended for accurate TMEM205 quantification:

  • RT-qPCR: RNA extraction followed by cDNA synthesis and quantitative PCR using TaqMan Gene Expression Assays. The PCR protocol typically involves preincubation at 50°C for 2 min, 95°C for 10 min, followed by 40 cycles at 95°C for 15 s and 60°C for 1 min. Results should be normalized to reference genes such as GAPDH .

  • RNA-Seq Analysis: For broader transcriptomic profiling, RNA-seq data analysis can be performed as used in TCGA and ICGC datasets. This approach allows for comprehensive assessment of TMEM205 expression in relation to other genes .

  • Immunohistochemistry: Using validated antibodies against TMEM205 to assess protein expression levels and localization patterns in tissue samples.

  • Statistical Analysis: Tools such as R packages "survival" and "survminer" are recommended for prognostic analyses, with the "surv_cutpoint" function useful for determining optimum expression cutpoints .

The choice between these methods depends on sample availability, research question, and whether protein or mRNA quantification is more relevant to the specific study.

How should experiments be designed to investigate TMEM205's role in cisplatin resistance mechanisms?

An effective experimental design to investigate TMEM205's role in cisplatin resistance should include:

  • Cell Line Selection:

    • Paired cisplatin-sensitive and resistant cell lines

    • TMEM205 knockout and overexpression models in the same genetic background

  • Resistance Characterization:

    • Dose-response curves to determine IC50 values for cisplatin

    • Long-term survival assays (colony formation)

    • Platinum accumulation studies using ICP-MS

  • Mechanistic Studies:

    • Co-immunoprecipitation experiments to identify TMEM205 interaction partners

    • Subcellular fractionation to track TMEM205 localization under different conditions

    • Site-directed mutagenesis of putative functional domains to identify critical residues

  • Functional Validation:

    • Rescue experiments in TMEM205-knockout cells

    • Combination studies with transport inhibitors

    • In vivo xenograft models comparing cisplatin sensitivity

This comprehensive approach allows for robust assessment of both correlative and causative relationships between TMEM205 and cisplatin resistance .

What controls should be included when studying TMEM205's interaction with the immune microenvironment?

When investigating TMEM205's impact on the immune microenvironment, the following controls are essential:

  • Expression Controls:

    • Isogenic cell lines with varying TMEM205 expression levels

    • Tissue-specific conditional knockouts to separate cancer cell-intrinsic from microenvironment effects

  • Immune Cell Controls:

    • Flow cytometry panels that comprehensively distinguish macrophage polarization states (M1 vs M2)

    • Markers for regulatory T cells and effector T cells to assess immune suppression

    • Comparison with other known immune modulators

  • Cytokine/Chemokine Assessment:

    • Multiplex cytokine assays to measure secreted factors

    • Neutralizing antibodies against key cytokines to confirm causality

    • Chemotaxis assays to verify functional recruitment

  • In Vivo Validation:

    • Syngeneic mouse models with intact immune systems

    • Depletion studies for specific immune cell populations

    • Immunocompetent vs. immunodeficient model comparisons

These controls help distinguish direct effects of TMEM205 on immune cells from indirect consequences of altered tumor biology .

What statistical approaches are most appropriate for analyzing correlations between TMEM205 expression and clinical outcomes?

The most appropriate statistical approaches for analyzing TMEM205 expression and clinical outcomes include:

  • Survival Analysis:

    • Kaplan-Meier analysis with log-rank tests to compare high versus low TMEM205 expression groups

    • Cox proportional hazards regression (both univariate and multivariate) to control for confounding clinical factors such as age, gender, pathologic stage, and grade

  • Expression Cutpoint Determination:

    • Objective determination of optimal cutpoints using algorithms like "surv_cutpoint" function in R's "survminer" package

    • Validation of cutpoints in independent cohorts

  • Correlation Analyses:

    • Pearson correlation analyses for continuous variables (with stringent significance thresholds, e.g., p < 0.0001)

    • Visualization using scatter plots and correlation matrices

  • Multivariate Modeling:

    • Construction of nomograms incorporating TMEM205 with established prognostic factors

    • Testing for interaction effects between TMEM205 and other clinical variables

All analyses should be performed using established statistical packages such as R 3.6.3 or later versions, with appropriate packages for survival analysis ("survival", "survminer") and visualization ("ggpubr", "corrplot") .

How should researchers interpret contradictory findings regarding TMEM205's role in different cancer types?

When faced with contradictory findings regarding TMEM205's role across different cancer types, researchers should consider:

  • Tissue Context Dependencies:

    • Different cancers have unique microenvironments that may interact differently with TMEM205

    • Baseline expression levels of TMEM205 and its binding partners may vary across tissues

  • Methodological Differences:

    • Variations in experimental approaches (in vitro vs. in vivo)

    • Differences in endpoint measurements (proliferation, resistance, immune effects)

    • Variability in TMEM205 detection methods and antibody specificity

  • Genetic Background Effects:

    • Co-occurring mutations may modify TMEM205's functional impact

    • Alternative splicing or post-translational modifications may generate tissue-specific variants

  • Statistical Considerations:

    • Sample size limitations in smaller studies

    • Multiple testing corrections and publication bias

When integrating contradictory data, researchers should prioritize findings from larger cohorts with robust methodology and independent validation. Meta-analysis approaches may help resolve discrepancies by identifying moderator variables that explain between-study heterogeneity .

What bioinformatic approaches can best reveal the functional networks involving TMEM205?

To effectively map functional networks involving TMEM205, researchers should employ these bioinformatic approaches:

  • Co-expression Analysis:

    • Weighted gene co-expression network analysis (WGCNA) to identify gene modules correlated with TMEM205

    • Analysis of TCGA and ICGC RNA-seq data across multiple cancer types to identify conserved patterns

  • Protein-Protein Interaction Mapping:

    • STRING database queries to identify known and predicted interaction partners

    • Analysis of proteomic data from immunoprecipitation-mass spectrometry experiments

  • Pathway Enrichment Analysis:

    • Gene Ontology (GO) and KEGG pathway analysis of genes correlated with TMEM205

    • Gene Set Enrichment Analysis (GSEA) using predefined gene sets related to drug resistance and immune function

  • Immune Cell Deconvolution:

    • Application of tools like EPIC to estimate the proportions of immune and stromal cells in the tumor microenvironment

    • Correlation of these proportions with TMEM205 expression levels

  • Multi-omics Integration:

    • Integration of transcriptomic, proteomic, and epigenetic data

    • Construction of causal networks using Bayesian approaches

These approaches can reveal both direct mechanistic links and broader functional relationships involving TMEM205, providing insights into its role in drug resistance and immune modulation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.