Recombinant Human Transmembrane protein 210 (TMEM210)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human Transmembrane Protein 210 (TMEM210)

Recombinant Human Transmembrane Protein 210 (TMEM210) is a synthetic version of the endogenous TMEM210 protein, engineered for research or therapeutic applications. It is expressed in E. coli with an N-terminal His tag for purification and structural studies. The recombinant protein spans amino acids 32–147 of the full-length sequence (A6NLX4) and retains transmembrane domains critical for its biological function .

Role in Cancer Prognosis

TMEM210 has emerged as a prognostic marker in osteosarcoma. A six-gene signature including TMEM210 was identified through LASSO-Cox regression analysis in The Cancer Genome Atlas (TCGA) and validated in external cohorts (e.g., GSE16091) . Key findings include:

StudyCohortTMEM210 RoleAUC Values
TCGA OsteosarcomaTraining/TestingRisk factor in signature0.771 (1-year), 0.750 (2-year), 0.736 (3-year)
GSE16091External cohortPredictor of poor survivalN/A

Key Research Data

Study TypeKey FindingsSource
Gene SignatureTMEM210 is part of a 6-gene osteosarcoma prognostic signature (risk score formula: risk score = TMEM59 + TMEM120B + TMEM147TMEM8ATMEM39BTMEM9B)
CRISPR/Cas9 KOTmem210 KO mice exhibited normal fertility; no overt phenotypic abnormalities
Protein ExpressionRecombinant TMEM210 expressed in E. coli; used for structural/functional assays

Potential Applications

  • Biomarker Development: TMEM210’s association with osteosarcoma survival warrants its exploration as a diagnostic or therapeutic target .

  • Research Tools: Recombinant TMEM210 serves as a model for studying transmembrane protein dynamics, particularly in cancer cell migration and apoptosis .

Gaps and Future Directions

  • Mechanistic Studies: No direct evidence links TMEM210 to specific signaling pathways (e.g., TGF-β, JAK/STAT) in cancer, unlike other TMEM proteins (e.g., TMEM45A) .

  • Functional Annotation: Experimental validation of TMEM210’s molecular function (e.g., ion transport, receptor activity) is lacking .

  • Therapeutic Potential: Its role in immune modulation (evidenced by GSEA) suggests potential for immunotherapy strategies .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, should you have specific format requirements, please clearly indicate them during order placement. We will then prepare accordingly.
Lead Time
Delivery time may vary based on the purchasing method or location. For precise delivery timelines, kindly consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipment is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We advise centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is decided during production. If you have a specified tag type in mind, please inform us, and we will prioritize developing it.
Synonyms
TMEM210; Transmembrane protein 210
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
32-147
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
TMEM210
Target Protein Sequence
TYCECSLGLSREALIALLVVLAGISASCFCALVIVAIGVLRAKGETCPRQVDNRLVENFGVQEDLMDLHPVYVESQLMDADLEVSLVPPLEDQSLVAIPMEASSEEPPPPPPLPPE
Uniprot No.

Target Background

Database Links

HGNC: 34059

KEGG: hsa:100505993

UniGene: Hs.512463

Subcellular Location
Membrane; Single-pass type I membrane protein.

Q&A

What is TMEM210 and what is known about its expression pattern?

TMEM210 (Transmembrane protein 210) is a testis-enriched gene that has been identified through gene expression analyses. Studies have shown that TMEM210 is predominantly expressed in mouse testes, suggesting a potential role in male reproductive biology . Expression analysis using digital PCR (heatmaps) has demonstrated tissue-specific expression patterns across various mouse and human reproductive and non-reproductive tissues. These analyses typically involve downloading sequences from Sequence Read Archives, trimming using tools like TrimGalore, and aligning to the human genome (GRCh38) or mouse genome (GRCm38) using tools such as HISAT2 . Feature Counts is then used to quantify gene expression in each tissue, with batch correction performed using methods like RUVr to remove unwanted variation.

What genomic editing approaches can be used to study TMEM210 function?

CRISPR/Cas9-mediated genome editing represents a powerful tool for functional analysis of TMEM210. Knockout (KO) mice can be generated to determine if TMEM210 is essential for sperm formation, function, and male fertility in vivo . The standard approach involves designing guide RNAs targeting the TMEM210 locus, followed by introduction of Cas9 protein/mRNA along with the guide RNAs into embryos. The following primers have been used successfully for TMEM210 CRISPR/Cas9 editing:

TargetPrimer SequenceAnnealing ConditionElongation Condition
Tmem210 (Up)tAGAGGTGTGTGGTGGGGTTGGGGG--
Tmem210 (Down)TTCCACAGTAGTGGAGAGCAACTAG--
Tmem210 (Forward 1)TCCTCTGCTTGCCTCAATCT60°C for 30s72°C for 30s
Tmem210 (Reverse 2)GGCCCGAAAGACACCAAT60°C for 30s72°C for 30s

For genotyping PCR, a 809 bp band is expected from this primer set .

What CRISPR-based activation systems are available for TMEM210 expression?

Commercial tools such as the TMEM210 Lentiviral Activation Particles utilize a Synergistic Activation Mediator (SAM) transcription activation system specifically designed to upregulate expression of the TMEM210 gene . This system employs a D10A and N863A deactivated Cas9 (dCas9) nuclease fused to a VP64 activation domain, in conjunction with a target-specific sgRNA engineered to bind the MS2-P65-HSF1 fusion protein . This combination provides a robust approach to maximize the activation of endogenous TMEM210 gene expression. The technology has been developed based on research demonstrating the efficacy of CRISPR-based activation systems for upregulating endogenous human genes .

How can efficient CRISPR/Cas9 genome editing of TMEM210 be optimized?

Optimization of TMEM210 genome editing requires careful consideration of guide RNA design, delivery method, and validation strategies. For maximum efficiency, the Targeted Knock-In with Two (TKIT) guides approach represents an advanced CRISPR/Cas9-based method that enables efficient and precise genomic knock-in . This approach is particularly valuable when targeting non-coding regions around TMEM210, as it is resistant to INDEL mutations.

When designing an experimental workflow, consider that while the TKIT method is resistant to INDELs in the coding region, it is not immune to other potential issues. For instance, if donor DNA is not present to replace the excised genomic DNA, a knockout allele could be generated instead of the intended knock-in . Therefore, it's crucial to validate both positive knock-ins and potential knockout effects in your experimental design through molecular and phenotypic characterization.

What are the optimal conditions for purifying recombinant TMEM210 protein?

Purification of recombinant TMEM210 can be approached with methods similar to those used for other mitochondrial transmembrane proteins. Based on successful purification strategies for similar proteins, a recommended approach involves expressing TMEM210 with deleted mitochondrial targeting signal sequence using an MBP-His10 fusion system in Escherichia coli . The recombinant protein typically inserts into the E. coli cell membrane and can be purified from isolated bacterial cell membranes through a two-step process:

  • Ni-NTA resin-based immobilized-metal affinity chromatography (IMAC)

  • Ion exchange purification

This approach has been validated for similar mitochondrial transmembrane proteins and provides functional protein that retains its binding capabilities with interaction partners . The purified protein can then be used for biochemical and structural studies to elucidate TMEM210's functional properties.

How can cell-type specific TMEM210 tagging be achieved in vivo?

For cell-type specific tagging of TMEM210 in vivo, a combinatorial approach using Cre-driver mouse lines and viral delivery systems is recommended. This methodology has been successful for tagging other proteins and can be adapted for TMEM210. The protocol involves breeding heterozygous tissue-specific Cre mice with homozygous lox-stop-lox conditional Cas9 animals to generate offspring with Cas9 expression in specific cell types .

High titer AAV carrying the TMEM210 tagging construct can then be injected into the target tissue. This approach allows for cell-type specific expression of the tagged protein, with efficiencies reported at approximately 16% for similar applications in vivo . While this is lower than in vitro efficiency (which can reach ~40%), it represents a practical approach for studying endogenously tagged TMEM210 in specific cell populations within intact tissues.

What strategies can be employed to investigate TMEM210 protein interactions and complexes?

Advanced investigation of TMEM210 protein interactions can be conducted using pulldown assays combined with mass spectrometry. This approach has been validated for similar transmembrane proteins and provides a powerful method to identify interaction partners . The experimental workflow involves:

  • Expressing recombinant TMEM210 with an appropriate affinity tag (such as MBP-His10)

  • Immobilizing the purified protein on an affinity resin

  • Incubating with cell lysates from relevant tissues/cells

  • Washing to remove non-specific binding

  • Eluting and analyzing bound proteins by mass spectrometry

This method can identify both stable and transient interactors of TMEM210, providing insights into its functional roles within cellular networks. The pulldown approach has been successfully used to validate interactions between similar mitochondrial transmembrane proteins and translation factors such as EF-Tu, suggesting that TMEM210 might also participate in specific protein-protein interactions that mediate its biological function .

How can TMEM210 function be studied in the context of fertility and spermatogenesis?

Given TMEM210's enriched expression in testis, studying its role in spermatogenesis requires combining knockout models with detailed phenotypic analysis. A comprehensive experimental approach would involve:

  • Generation of TMEM210 knockout mice using CRISPR/Cas9 technology

  • Detailed fertility testing, including analysis of:

    • Mating behavior and success

    • Sperm count, morphology, and motility

    • Testicular histology with stage-specific analysis of spermatogenesis

    • Molecular markers of meiotic progression

    • Hormonal profiling (testosterone, FSH, LH)

For advanced mechanistic studies, single-cell RNA sequencing can be employed to characterize cell-type specific effects of TMEM210 disruption. This approach allows decomposition of data into multiple components that can identify novel gene-regulatory programs affected by TMEM210 disruption . By jointly analyzing mutant and wild-type cells, researchers can uncover the specific cell types and developmental stages in which TMEM210 plays critical roles.

What approaches are available for studying TMEM210 dynamics and localization in living cells?

To study TMEM210 dynamics and subcellular localization in living cells, endogenous tagging with fluorescent proteins offers significant advantages over exogenous expression. The TKIT method can be adapted to introduce fluorescent tags such as GFP or Super Ecliptic pHluorin (SEP) to the N-terminus or C-terminus of TMEM210, depending on the protein's topology . This approach has achieved tagging efficiencies of up to 42% in primary cultured neurons for other proteins.

For quantitative analysis of TMEM210 dynamics, fluorescence recovery after photobleaching (FRAP) can be employed with endogenously tagged TMEM210 . This technique provides valuable data on protein mobility and turnover rates within specific subcellular compartments. For long-term studies, the stability of knock-in tags has been demonstrated for periods exceeding one year in vivo, indicating that this approach is suitable for longitudinal studies of TMEM210 dynamics .

How should single-cell RNA-seq data be analyzed to understand TMEM210 expression patterns in complex tissues?

Analysis of TMEM210 expression in complex tissues like testis requires sophisticated computational approaches to single-cell RNA-seq data. A model-based factor analysis method such as SDA (Sparse Decomposition of Arrays) can be employed to jointly analyze cells from both wild-type and mutant tissues . This approach allows decomposition of the data into components that identify novel gene-regulatory programs and cell types.

The analytical workflow should include:

  • Quality control and normalization of single-cell RNA-seq data

  • Dimensionality reduction using methods like PCA, t-SNE, or UMAP

  • Clustering to identify cell populations

  • Differential expression analysis to determine TMEM210 expression patterns across cell types

  • Trajectory analysis to map TMEM210 expression along developmental processes

  • Integration with other datasets (such as proteomics or epigenomics) for multi-modal insights

This comprehensive analytical approach can reveal not only where and when TMEM210 is expressed, but also which genes are co-regulated with it, providing insights into its functional networks and potential roles in specific cell types .

What bioinformatic approaches can predict TMEM210 protein structure and function?

Given the challenges in experimental determination of transmembrane protein structures, computational approaches offer valuable insights into TMEM210 structure and function. A recommended bioinformatic workflow includes:

  • Sequence analysis to identify conserved domains, motifs, and transmembrane regions

  • Homology modeling based on structurally characterized proteins with similar sequences

  • Molecular dynamics simulations to predict protein stability and dynamic behavior

  • Protein-protein interaction prediction using co-evolution analysis and docking methods

  • Integration of genomic, transcriptomic, and proteomic data to infer functional networks

These computational approaches can generate testable hypotheses about TMEM210 function that guide experimental design. For instance, if structural predictions suggest potential interaction interfaces, these can be targeted for mutagenesis studies to validate their functional significance.

What are common challenges in TMEM210 CRISPR editing and how can they be addressed?

CRISPR/Cas9 editing of TMEM210 may encounter several challenges that require specific optimization strategies:

  • Low editing efficiency: This can be addressed by testing multiple guide RNAs and selecting those with high predicted efficiency and specificity. For TMEM210, designing guides targeting non-coding regions using the TKIT approach has shown resistance to INDEL mutations and improved efficiency .

  • Off-target effects: These can be minimized by careful guide RNA design and validation of potential off-target sites by sequencing. Using Cas9 variants with enhanced specificity can also reduce off-target editing.

  • Mosaic editing: This is particularly challenging in in vivo applications. Delivering Cas9 and guide RNAs at the earliest possible developmental stage or using cell-type specific approaches with high-efficiency delivery systems can help achieve more uniform editing .

  • Knockout validation: For TMEM210, standard PCR-based genotyping may be supplemented with mRNA and protein level validation. The primer sets provided in the methodology section can be used for initial screening, followed by sequencing to confirm the exact nature of the edits .

What strategies can overcome challenges in recombinant TMEM210 expression and purification?

As a transmembrane protein, TMEM210 presents specific challenges for recombinant expression and purification. Based on successful approaches with similar proteins, the following strategies are recommended:

  • Solubility issues: Deletion of the mitochondrial targeting signal sequence and fusion with solubility-enhancing tags such as MBP can improve expression and solubility .

  • Membrane insertion: Expression in E. coli leads to insertion into bacterial cell membranes, requiring specialized extraction methods. Careful optimization of detergents for membrane solubilization is crucial for maintaining protein structure and function .

  • Purification optimization: A two-step purification process combining IMAC and ion exchange chromatography has proven effective for similar transmembrane proteins and can be adapted for TMEM210 .

  • Functional validation: Pulldown assays with potential interaction partners from relevant cell lysates can confirm that the purified protein retains its functional properties, as demonstrated for other mitochondrial transmembrane proteins .

By implementing these specialized approaches, researchers can overcome the inherent challenges associated with transmembrane protein biochemistry and generate high-quality recombinant TMEM210 for structural and functional studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.