Recombinant Human Transmembrane protein 211 (TMEM211)

Shipped with Ice Packs
In Stock

Description

Expression and Localization

TMEM211 exhibits tissue-specific expression:

Tissue/ConditionExpression LevelNotes
Pancreatic isletsVery highLocalized to insulin-secreting β-cells
Sun-exposed skinHighLinked to calcitriol (vitamin D) signaling
Triple-negative breast cancerOverexpressedPotential biomarker
Colon cancerElevated in tumorsCorrelates with poor prognosis

In Alzheimer’s disease and obesity, TMEM211 levels are significantly upregulated .

Insulin Signaling

TMEM211 is enriched in pancreatic β-cells, where it may modulate insulin secretion. Proposed mechanisms include:

  • Binding glucose or hormones (e.g., leptin, GLP-1) via its extracellular domain .

  • Regulating stress responses in β-cells through calcitriol signaling .

Cancer Progression

In colon cancer, TMEM211 drives metastasis by:

  • Promoting epithelial-mesenchymal transition (EMT) via downregulation of E-cadherin and upregulation of N-cadherin, Snail, and Twist1 .

  • Activating ERK, AKT, and NF-κB pathways (Table 1) .

Table 1: Impact of TMEM211 Silencing in Colon Cancer Cells

ParameterChange in TMEM211-Silenced Cellsp-Value
Invasion↓ 50–60%<0.001
p-ERK↓ 30–40%<0.05
p-AKT↓ 25–35%<0.05
p-RelA (NF-κB)↓ 20–30%<0.05
Data derived from HCT116 and DLD-1 cell experiments .

Prognostic Value in Colon Cancer

High TMEM211 expression correlates with reduced survival (Table 2):
Table 2: Survival Analysis of Colon Cancer Patients (TCGA Data)

Survival MetricAdjusted Hazard Ratio (High vs. Low TMEM211)95% CIp-Value
Disease-Specific Survival2.301.15–4.600.019
Progression-Free Survival1.911.11–3.270.019

Association with EMT Markers

Co-expression with Snail or Slug increases mortality risk (AHR = 11.84 and 5.11, respectively) .

Regulatory Mechanisms

  • Transcription factors: FEZF1.02 and VDR_RXR.03 (vitamin D receptor complex) regulate TMEM211 expression .

  • Hormonal modulation: Estrogen enhances calcitriol bioavailability, indirectly stabilizing TMEM211 levels .

Experimental Insights

Proposed studies for recombinant TMEM211 applications:

  • Surface plasmon resonance: Test binding affinity for glucose, fatty acids, or hormones .

  • Therapeutic targeting: Small-molecule inhibitors to block TMEM211’s interaction with ERK/AKT pathways .

Interaction Network

STRING database predictions highlight associations with:

  • Signaling proteins: GPR137C, GPR162, BAI2 .

  • Other TMEMs: TMEM150C, TMEM221 .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for precise delivery times.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default glycerol final concentration is 50% and can be used as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please communicate it to us, and we will prioritize its development.
Synonyms
TMEM211; Transmembrane protein 211
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-200
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
TMEM211
Target Protein Sequence
MLSSVWVALGLSLTCTSAFSLISPAWFQTPTFSFGILTYCSWPQGNSWNQSCVTFSSLED IPDFAWKVSAVMLLGGWLLLAFNAIFLLSWAVAPKGLCPRRSSVPMPGVQAVAATAMIVG LLIFPIGLASPFIKEVCEASSMYYGGKCRLGWGYMTAILNAVLASLLPIISWPHTTKVQG RTIIFSSATERIIFVPEMNK
Uniprot No.

Target Background

Gene References Into Functions
  1. Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator) PMID: 20379614
Database Links

HGNC: 33725

KEGG: hsa:255349

STRING: 9606.ENSP00000372192

UniGene: Hs.329040

Protein Families
TMEM211 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is TMEM211 and what biological functions has it been associated with?

TMEM211 is a transmembrane protein that has been identified as a potential oncogenic factor in colon cancer. Research indicates that TMEM211 is highly expressed in tumor tissues compared to normal tissues in colon cancer patients. Studies show that TMEM211 regulates epithelial-mesenchymal transition (EMT) for metastasis through coactivating multiple signaling pathways, including ERK, AKT, and NF-κB . The protein appears to play a critical role in promoting tumor progression and metastasis in colon cancer, making it a potential biomarker and therapeutic target.

The differential expression of TMEM211 between normal and tumor tissues is statistically significant, with tumor tissues showing significantly higher expression levels (mean ± SD = 3.82 ± 2.05) compared to normal tissues (mean ± SD = 1.43 ± 0.98) (p < 0.001) .

How does TMEM211 compare to other transmembrane proteins in terms of structure and function?

TMEM211 belongs to the broader family of transmembrane proteins (TMEMs), many of which have been implicated in various aspects of cancer biology. While specific structural information about TMEM211 is limited in current research, functional studies suggest it shares mechanistic similarities with other TMEMs in cancer progression.

Network analysis has identified potential interactions between TMEM211 and other molecules, including GPR137C, GPR162, BAI2, KIAA1257, OVOL3, TMEM150C, TMEM132E, TMEM221, TMEM171, and TMEM212 . This suggests TMEM211 may function within a broader network of transmembrane proteins and signaling molecules to influence cancer cell behavior.

What cellular processes does TMEM211 regulate in normal versus cancerous tissues?

In cancerous tissues, TMEM211 appears to regulate several key processes related to metastasis:

  • Cell migration and invasion: TMEM211 silencing reduces migration and invasion abilities in colon cancer cells (HCT116 and DLD-1) .

  • Epithelial-mesenchymal transition (EMT): TMEM211-silenced colon cancer cells show decreased levels of mesenchymal markers (Twist1, N-cadherin, Snail, and Slug) and increased levels of epithelial markers (E-cadherin) .

  • Signaling pathway activation: TMEM211 appears to activate ERK, AKT, and NF-κB signaling pathways, as evidenced by decreased phosphorylation of ERK, AKT, and RelA (NF-κB p65) in TMEM211-silenced cells .

  • Matrix metalloproteinase regulation: Preliminary evidence suggests TMEM211 might regulate MMP9 activity, potentially contributing to extracellular matrix degradation during metastasis .

The function of TMEM211 in normal tissues remains less characterized, though its significantly lower expression in normal tissues suggests a more specialized or limited role.

What expression systems are most suitable for producing functional recombinant TMEM211?

For transmembrane proteins like TMEM211, mammalian expression systems are generally preferred over bacterial systems to ensure proper folding, post-translational modifications, and insertion into membranes. Recommended approaches include:

  • Human cell lines (HEK293 or HeLa cells): These provide a native environment for human TMEM211 expression with appropriate chaperones and folding machinery.

  • Insect cell expression systems (Sf9 or High Five cells): These systems often yield higher protein quantities while maintaining proper folding for transmembrane proteins.

  • Cell-free expression systems with appropriate membrane mimetics: This approach can be useful for rapid screening and optimization.

When designing expression constructs, researchers should consider including purification tags (His6, FLAG, or Strep-tag) positioned to avoid interference with transmembrane domains and protein function.

What purification strategies yield the highest quality recombinant TMEM211?

Purification of recombinant TMEM211 requires specialized approaches due to its transmembrane nature:

  • Membrane fraction isolation: Begin with careful cell lysis and differential centrifugation to isolate membrane fractions.

  • Detergent screening: Test multiple detergents (DDM, LMNG, Digitonin) for optimal solubilization while maintaining protein integrity.

  • Affinity chromatography: Utilize the purification tag (His6, FLAG) for initial capture.

  • Size exclusion chromatography: This critical step separates properly folded protein from aggregates.

  • Validation of protein quality through multiple methods, including SDS-PAGE, Western blotting, and functional assays (binding studies or cell-based assays based on TMEM211's known functions in EMT and signaling).

How can researchers verify the structural integrity and functionality of purified recombinant TMEM211?

Verification of recombinant TMEM211 quality should include:

  • Biophysical characterization:

    • Circular dichroism (CD) spectroscopy to assess secondary structure

    • Thermal stability assays to determine protein folding quality

    • Dynamic light scattering to evaluate homogeneity

  • Functional validation:

    • Cell-based assays measuring effects on migration, invasion, or EMT marker expression

    • Binding assays with known interaction partners

    • Phosphorylation status of downstream targets (ERK, AKT, RelA)

  • Structural integrity:

    • Limited proteolysis to assess folding

    • Mass spectrometry to confirm sequence and modifications

    • Transmission electron microscopy if reconstituted into lipid nanodiscs or liposomes

How can recombinant TMEM211 be used to study its role in cancer progression?

Recombinant TMEM211 can serve as a valuable tool for multiple research applications:

  • Structure-function studies: Using recombinant TMEM211 variants with specific mutations to identify domains critical for its functions in promoting EMT and metastasis.

  • Interaction studies: Pull-down assays, co-immunoprecipitation, or surface plasmon resonance to identify binding partners involved in TMEM211's activation of ERK, AKT, and NF-κB pathways.

  • Competitive inhibition studies: Using recombinant TMEM211 fragments to potentially block interactions essential for its oncogenic functions.

  • Antibody development: Generating and validating antibodies against TMEM211 for detection, imaging, or potential therapeutic applications.

  • In vitro reconstitution of TMEM211-dependent signaling: Creating defined systems to elucidate the molecular mechanisms by which TMEM211 activates downstream pathways.

What methodological approaches are most effective for investigating TMEM211's role in EMT?

Based on current research, several approaches are recommended for studying TMEM211's role in EMT:

  • Gene silencing experiments: siRNA or CRISPR-Cas9 approaches targeting TMEM211, followed by assessment of EMT markers. Research has shown that TMEM211-silenced colon cancer cells exhibit decreased levels of Twist1, N-cadherin, Snail and Slug, but increased levels of E-cadherin .

  • Overexpression studies: Introducing recombinant TMEM211 into cell lines with low endogenous expression to observe effects on EMT marker expression and cell behavior.

  • Rescue experiments: Reintroducing wild-type or mutant TMEM211 into TMEM211-silenced cells to identify critical domains and residues.

  • Real-time monitoring of EMT: Using live-cell imaging with fluorescent markers for EMT-related proteins to track dynamic changes upon TMEM211 modulation.

  • 3D culture systems: Employing organoids or spheroid cultures to study TMEM211's effects on EMT in more physiologically relevant contexts than traditional 2D cultures.

What assays can quantify TMEM211's effects on cell migration and invasion?

Multiple complementary assays can be employed to quantitatively assess TMEM211's effects on cancer cell migration and invasion:

  • Wound healing/scratch assays: Measuring the rate of wound closure in monolayers of cells with varying TMEM211 expression levels.

  • Transwell migration assays: Quantifying cell migration through permeable supports.

  • Invasion assays: Measuring invasion through Matrigel or other extracellular matrix components.

  • Single-cell tracking: Using live-cell imaging to track individual cell movement parameters (velocity, directionality, persistence).

  • 3D spheroid invasion assays: Monitoring invasion from tumor spheroids into surrounding matrix.

  • Matrix metalloproteinase activity assays: Zymography to assess MMP9 activity, which has been shown to be slightly decreased in TMEM211-silenced cells .

How does TMEM211 activate ERK, AKT, and NF-κB signaling pathways?

Current research indicates that TMEM211 acts as a co-activator of multiple signaling pathways relevant to cancer progression:

  • ERK pathway: TMEM211 silencing decreases phosphorylated ERK levels in colon cancer cells, suggesting TMEM211 promotes ERK activation . The exact mechanism remains to be fully elucidated, but may involve interaction with upstream regulators of the MAPK pathway.

  • AKT pathway: Similarly, TMEM211-silenced cells show decreased phosphorylation of AKT , indicating TMEM211 influences the PI3K/AKT pathway, potentially through direct or indirect interactions with pathway components.

  • NF-κB pathway: Decreased phosphorylation of RelA (NF-κB p65) is observed in TMEM211-silenced cells , suggesting TMEM211 contributes to NF-κB activation, which is known to promote inflammation and cancer progression.

Further research using specific inhibitors of these pathways alongside TMEM211 modulation would help clarify whether TMEM211 activates these pathways in parallel or sequentially.

What experimental controls are essential when studying TMEM211's effects on cell signaling?

When investigating TMEM211's impact on signaling pathways, several critical controls should be implemented:

  • Pathway-specific positive controls: Treatment with known activators of each pathway (e.g., EGF for ERK, insulin for AKT, TNF-α for NF-κB).

  • Pathway-specific inhibitors: Using selective inhibitors (e.g., U0126 for MEK/ERK, MK-2206 for AKT, BAY 11-7082 for NF-κB) to confirm specificity of observed effects.

  • Time-course experiments: Evaluating activation kinetics to distinguish direct from indirect effects.

  • Dose-dependent responses: Testing different levels of TMEM211 expression or silencing.

  • Rescue experiments: TMEM211-silenced cells with re-expression of TMEM211 are essential for verifying the activation of signaling pathways .

  • Cell type controls: Comparing effects across multiple relevant cell lines to ensure observations are not cell-line-specific artifacts.

How can researchers identify downstream mediators of TMEM211 signaling?

To identify downstream mediators that link TMEM211 to ERK, AKT, and NF-κB signaling, researchers should consider:

  • Phosphoproteomic analysis: Comparing phosphorylation profiles between control and TMEM211-modulated cells to identify differentially phosphorylated proteins.

  • Proximity labeling approaches: Using BioID or APEX2 fused to TMEM211 to identify proteins in close proximity that might be direct interactors.

  • Co-immunoprecipitation followed by mass spectrometry: Identifying protein complexes associated with TMEM211.

  • Transcriptomic analysis: RNA-seq to identify genes differentially expressed upon TMEM211 modulation.

  • Chromatin immunoprecipitation (ChIP): For suspected transcription factors (like NF-κB components) to identify target genes regulated by TMEM211-dependent signaling.

  • CRISPR screens: To identify genes whose loss mimics or suppresses TMEM211-dependent phenotypes.

How can TMEM211 expression data be used for cancer prognosis?

TMEM211 expression has shown significant association with cancer prognosis in colon cancer patients:

  • Survival correlation: Colon cancer patients with high TMEM211 expression demonstrate poor progression-free interval survival (PFIS, adjusted hazard ratio: 1.91, 95% CI: 1.11–3.27, p = 0.019) and disease-specific survival (DSS, AHR: 2.30, 95% CI: 1.15–4.60, p = 0.019) .

  • Tumor size association: Higher TMEM211 expression is particularly associated with poor DSS in colon cancer patients with larger tumor size (T3 + T4) [AHR = 2.39, 95% CI: 1.18–4.85, p = 0.016] .

TMEM211 ExpressionROCNo. (%)CHR (95% CI)p ValueAHR (95% CI)p Value
Progression-free interval survival
Low89 (32.8)1.001.00
High182 (67.2)1.72 (1.00–2.95)0.0471.91 (1.11–3.27)0.019
Disease-specific survival
Low139 (54.3)1.001.00
High117 (45.7)1.81 (0.91–3.59)0.0902.30 (1.15–4.60)0.019

These findings suggest TMEM211 expression could serve as a prognostic biomarker, particularly for stratifying risk in patients with larger tumors.

What methodologies are recommended for measuring TMEM211 in clinical samples?

For clinical implementation of TMEM211 as a biomarker, several methodological approaches are recommended:

  • RNA-based methods:

    • RT-qPCR for TMEM211 mRNA quantification in fresh/frozen tissues

    • RNA in situ hybridization for TMEM211 mRNA detection in FFPE samples

  • Protein-based methods:

    • Immunohistochemistry (IHC) for spatial distribution in tissue sections

    • ELISA or other immunoassays if TMEM211 or fragments are released into circulation

  • Standardization considerations:

    • Inclusion of reference gene panels for normalization

    • Development of scoring systems for IHC (H-score, Allred score)

    • Determination of clinically relevant cutoff values (similar to the ROC approach used in the study)

  • Technical validation:

    • Comparison across multiple detection methods

    • Assessment of inter- and intra-observer variability

    • Evaluation in multi-center settings

How might therapeutic strategies targeting TMEM211 be developed and evaluated?

Based on current understanding of TMEM211's roles in cancer progression, several therapeutic approaches could be explored:

  • Direct targeting strategies:

    • Monoclonal antibodies against extracellular domains of TMEM211

    • Small molecule inhibitors targeting functional domains

    • RNA interference approaches (siRNA, antisense oligonucleotides)

  • Indirect targeting approaches:

    • Inhibitors of downstream pathways (ERK, AKT, NF-κB)

    • Disruption of protein-protein interactions critical for TMEM211 function

  • Evaluation methodologies:

    • Cell-based screening assays measuring TMEM211-dependent phenotypes

    • Patient-derived xenograft models with varying TMEM211 expression

    • Assessment of effects on EMT, invasion, and signaling pathway activation

  • Combination strategies:

    • TMEM211 inhibition combined with conventional chemotherapy

    • Dual targeting of TMEM211 and other EMT regulators

    • Complementary targeting of multiple signaling pathways

How does TMEM211 interact with the tumor microenvironment?

While direct evidence of TMEM211's interaction with the tumor microenvironment is limited in current research, several possibilities warrant investigation:

  • Extracellular matrix interaction: TMEM211's potential regulation of MMP9 activity suggests it may influence extracellular matrix remodeling , which could affect tumor microenvironment composition and cancer cell invasion.

  • Tumor-stroma communication: As a transmembrane protein, TMEM211 might participate in signaling between cancer cells and stromal components.

  • Immune modulation: Given TMEM211's effect on NF-κB signaling , which regulates inflammatory responses, it may influence tumor-immune interactions.

  • Angiogenesis: The potential link between TMEM211, EMT, and invasiveness suggests possible roles in promoting angiogenesis that support metastatic spread.

These hypothetical interactions require experimental validation through co-culture systems, 3D models incorporating stromal and immune components, and in vivo studies.

What are the challenges in developing TMEM211 as a therapeutic target, and how might they be addressed?

Developing therapeutics targeting TMEM211 presents several challenges:

  • Transmembrane protein accessibility: The membrane-embedded nature of TMEM211 may limit accessibility to certain domains. This could be addressed by:

    • Detailed structural characterization to identify accessible epitopes or domains

    • Development of cell-penetrating inhibitors for intracellular domains

    • Focus on disrupting critical protein-protein interactions

  • Specificity concerns: Ensuring selectivity for TMEM211 over other TMEMs requires:

    • Comprehensive sequence and structural comparisons to identify unique features

    • Careful counter-screening against related proteins

    • Structure-guided drug design based on unique TMEM211 features

  • Delivery challenges: Especially for nucleic acid-based therapeutics targeting TMEM211:

    • Development of nanoparticle or liposomal formulations

    • Tumor-targeted delivery systems

    • Exploration of local delivery for accessible tumors

  • Resistance mechanisms: Potential development of resistance through:

    • Upregulation of alternative pathways

    • TMEM211 mutations affecting drug binding

    • Requires combination approaches and resistance monitoring strategies

How can multi-omics approaches advance our understanding of TMEM211 biology?

Integrated multi-omics strategies offer powerful approaches to comprehensively understand TMEM211 biology:

  • Genomics and epigenomics:

    • Analysis of TMEM211 gene alterations (mutations, copy number variations) across cancer types

    • Characterization of epigenetic regulation of TMEM211 expression

    • Identification of genetic modifiers of TMEM211 function

  • Transcriptomics:

    • RNA-seq to identify gene expression changes downstream of TMEM211

    • Single-cell transcriptomics to capture heterogeneity in TMEM211 expression and function

    • Analysis of alternative splicing of TMEM211

  • Proteomics and interactomics:

    • Identification of TMEM211 protein interaction networks

    • Phosphoproteomics to map TMEM211-dependent signaling events

    • Characterization of TMEM211 post-translational modifications

  • Metabolomics:

    • Analysis of metabolic changes associated with TMEM211 expression

    • Identification of potential metabolic vulnerabilities in TMEM211-high cancers

  • Integrated analysis:

    • Correlation of TMEM211 expression with mutations in ERK, AKT, and NF-κB pathway components

    • Network analysis incorporating proteomic, transcriptomic, and clinical data

    • Machine learning approaches to identify patterns and therapeutic opportunities

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.