Recombinant Human Transmembrane protein 214 (TMEM214)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is determined during production. Please specify your required tag type for prioritized development.
Synonyms
TMEM214; PP446; Transmembrane protein 214
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-689
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
TMEM214
Target Protein Sequence
MATKTAGVGRWEVVKKGRRPGVGAGAGGRGGGRNRRALGEANGVWKYDLTPAIQTTSTLY ERGFENIMKRQNKEQVPPPAVEPKKPGNKKQPKKVATPPNQNQKQGRFRSLEEALKALDV ADLQKELDKSQSVFSGNPSIWLKDLASYLNYKLQAPLSEPTLSQHTHDYPYSLVSRELRG IIRGLLAKAAGSLELFFDHCLFTMLQELDKTPGESLHGYRICIQAILQDKPKIATANLGK FLELLRSHQSRPAKCLTIMWALGQAGFANLTEGLKVWLGIMLPVLGIKSLSPFAITYLDR LLLMHPNLTKGFGMIGPKDFFPLLDFAYMPNNSLTPSLQEQLCQLYPRLKVLAFGAKPDS TLHTYFPSFLSRATPSCPPEMKKELLSSLTECLTVDPLSASVWRQLYPKHLSQSSLLLEH LLSSWEQIPKKVQKSLQETIQSLKLTNQELLRKGSSNNQDVVTCDMACKGLLQQVQGPRL PWTRLLLLLLVFAVGFLCHDLRSHSSFQASLTGRLLRSSGFLPASQQACAKLYSYSLQGY SWLGETLPLWGSHLLTVVRPSLQLAWAHTNATVSFLSAHCASHLAWFGDSLTSLSQRLQI QLPDSVNQLLRYLRELPLLFHQNVLLPLWHLLLEALAWAQEHCHEACRGEVTWDCMKTQL SEAVHWTWLCLQDITVAFLDWALALISQQ
Uniprot No.

Target Background

Function

TMEM214 is a critical mediator of endoplasmic reticulum (ER) stress-induced apoptosis. In collaboration with CASP4, it is required for CASP4 activation following ER stress.

Gene References Into Functions
  1. TMEM214 is crucial for ER stress-induced apoptosis. It acts as an anchor, recruiting procaspase 4 to the ER for subsequent activation. PMID: 23661706
Database Links

HGNC: 25983

OMIM: 615301

KEGG: hsa:54867

STRING: 9606.ENSP00000238788

UniGene: Hs.533934

Protein Families
TMEM214 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of human TMEM214?

Human TMEM214 is a 689-amino acid transmembrane protein containing two putative transmembrane domains located at amino acids 480-500 and 616-636. Structural analysis indicates that TMEM214 is primarily localized on the outer membrane of the endoplasmic reticulum. The protein contains an N-terminal cytoplasmic region (amino acids 176-354) that is critical for its interaction with procaspase 4. Either of the two transmembrane domains is sufficient for ER localization, while both the N-terminal cytoplasmic region and at least one transmembrane domain are required for its apoptotic function.

Where is TMEM214 primarily localized in human cells?

TMEM214 is predominantly localized to the outer membrane of the endoplasmic reticulum. Confocal microscopy analysis demonstrates that TMEM214 colocalizes extensively with ER markers such as Sec61β, while showing minimal overlap with Golgi body or mitochondrial markers. Cell fractionation and immunoblot analyses confirm that endogenous TMEM214 exists primarily in the ER-containing membrane fraction, with minimal presence in mitochondria and undetectable levels in the cytosol. Trypsin-protection assays using purified membrane fractions indicate that TMEM214 is sensitive to trypsin treatment, similar to procaspase 4, whereas ER lumen proteins like Bip are protected, further confirming its outer membrane localization.

What is the primary function of TMEM214 in cellular biology?

TMEM214 functions as a critical mediator of ER stress-induced apoptosis by serving as an anchor protein that facilitates the recruitment and activation of procaspase 4 to the endoplasmic reticulum. Experimental evidence demonstrates that TMEM214 constitutively associates with procaspase 4 under both basal and ER stress conditions. This interaction is essential for the localization of procaspase 4 to the ER, its subsequent activation, and the initiation of the apoptotic cascade. TMEM214-mediated apoptosis appears to operate independently of other ER stress response pathways, such as CHOP induction and JNK phosphorylation.

What are the recommended methods for overexpressing and studying TMEM214 in cellular models?

For effective TMEM214 overexpression studies, the following methodological approach is recommended:

  • Expression Construct Design:

    • Create mammalian expression plasmids containing human FLAG- or cherry-tagged TMEM214 and its truncated mutants using standard molecular biology techniques.

    • For functional domain studies, develop constructs with specific mutations or deletions in the transmembrane domains (amino acids 480-500 and 616-636) and the N-terminal cytoplasmic region (amino acids 176-354).

  • Transfection Protocol:

    • Use standard calcium phosphate precipitation methods for 293 cells or lipid-based transfection reagents for other cell lines.

    • Typical experimental timeframe: Observe transfected cells 20-24 hours post-transfection for morphological changes associated with apoptosis.

  • Analytical Methods:

    • Assess apoptotic morphology (round-up morphology and detachment from culture dishes)

    • Perform annexin V staining to quantify apoptotic cells

    • Conduct DNA fragmentation assays to confirm apoptotic phenotype

    • Use dose-dependent expression studies (varying plasmid concentrations) to establish causal relationships

How can researchers effectively knockdown TMEM214 to study its function?

For TMEM214 knockdown experiments, researchers should implement the following protocol:

  • RNAi Design Strategy:

    • Design multiple RNAi plasmids targeting different sites of human TMEM214 mRNA to ensure specificity and effectiveness.

    • Based on published research, at least three different RNAi constructs should be tested, with RNAi #2 and #3, as referenced in the literature, demonstrating significant knockdown efficiency.

  • Delivery Method:

    • Employ retroviral-mediated gene transfer for stable transduction into cell lines such as HeLa.

    • For transient knockdown, lipid-based transfection of siRNA duplexes can be used as an alternative approach.

  • Validation of Knockdown:

    • Confirm knockdown efficiency through Western blot analysis using specific antibodies against TMEM214.

    • Assess functional consequences by exposing cells to ER stress inducers like thapsigargin (TG) or brefeldin A (BFA).

    • Compare apoptotic responses between knockdown and control cells using annexin V staining and caspase activity assays.

  • Control Experiments:

    • Include stimuli that induce apoptosis through non-ER stress pathways (TNFα, actinomycin D, etoposide) to confirm the specificity of TMEM214's role in ER stress-induced apoptosis.

What methods can be used to study the interaction between TMEM214 and procaspase 4?

To investigate the TMEM214-procaspase 4 interaction, researchers should employ a multi-method approach:

  • Coimmunoprecipitation (Co-IP):

    • Perform Co-IP experiments using antibodies against either TMEM214 or procaspase 4 under both basal and ER stress conditions (TG or BFA stimulation).

    • Use appropriate controls including IgG controls and lysates from TMEM214-knockdown cells.

    • Western blot analysis of immunoprecipitates to detect interaction partners.

  • Domain Mapping:

    • Generate truncated mutants of TMEM214 to identify regions required for procaspase 4 binding.

    • Create expression constructs containing different segments of TMEM214 (e.g., N-terminal region, transmembrane domains, C-terminal region).

    • Perform Co-IP experiments with these constructs to determine the minimal region necessary for interaction.

  • Subcellular Fractionation:

    • Isolate ER fractions from control and TMEM214-knockdown cells.

    • Analyze the presence of procaspase 4 in these fractions by immunoblotting.

    • Compare procaspase 4 levels in ER fractions before and after ER stress induction.

  • Confocal Microscopy:

    • Perform immunofluorescence staining for both TMEM214 and procaspase 4.

    • Use ER markers (e.g., Sec61β) to confirm colocalization at the ER.

    • Compare localization patterns in control versus stress conditions.

How does TMEM214 mediate ER stress-induced apoptosis?

TMEM214 mediates ER stress-induced apoptosis through the following mechanism:

  • Procaspase 4 Recruitment: TMEM214 constitutively associates with procaspase 4 through its N-terminal cytoplasmic region (amino acids 176-354), serving as an anchor to recruit procaspase 4 to the ER membrane.

  • Localization to ER: The transmembrane domains of TMEM214 (amino acids 480-500 and 616-636) ensure its proper localization to the ER membrane, with either domain being sufficient for ER targeting.

  • Procaspase 4 Activation: Upon ER stress induction (e.g., by thapsigargin or brefeldin A), TMEM214 facilitates the activation and cleavage of procaspase 4. Knockdown of TMEM214 significantly inhibits procaspase 4 cleavage following ER stress.

  • Apoptotic Cascade: Activated caspase 4 initiates the apoptotic cascade, leading to the cleavage of downstream substrates like PARP-1 and eventual cell death.

  • Pathway Independence: TMEM214-mediated apoptosis operates independently of other ER stress response pathways such as CHOP induction and JNK phosphorylation, as evidenced by the observation that TMEM214 knockdown does not affect TG-induced JNK phosphorylation or CHOP induction.

How is TMEM214-mediated apoptosis different from other apoptotic pathways?

TMEM214-mediated apoptosis displays several distinct features compared to other apoptotic pathways:

FeatureTMEM214-Mediated ER Stress ApoptosisExtrinsic Apoptosis (Death Receptor)Intrinsic Apoptosis (Mitochondrial)
Key MediatorsTMEM214, Caspase 4TNFR, TRAIL-R, Fas, Caspase 8Bcl-2 family, Cytochrome c, Caspase 9
Triggering StimuliER stress inducers (TG, BFA)TNFα, FasL, TRAILDNA damage, oxidative stress
Primary LocationEndoplasmic reticulumPlasma membraneMitochondria
Independent of CHOPYesYesYes
Independent of JNKYesNoNo
Affected by TMEM214 KDStrongly inhibited (>30% reduction)Not significantly affectedNot significantly affected
Requires Caspase 4EssentialNot requiredNot required
Requires Caspase 8Not requiredEssentialNot required

This pathway specificity is evidenced by experimental data showing that knockdown of TMEM214 significantly inhibits apoptosis induced by ER stress inducers (TG, BFA) but has no marked effect on apoptosis triggered by TNFα (extrinsic pathway) or actinomycin D and etoposide (intrinsic pathway).

What is the relationship between caspase 4 and TMEM214 in the context of ER stress-induced apoptosis?

Caspase 4 and TMEM214 demonstrate a mutual dependency in ER stress-induced apoptosis:

  • Physical Association: TMEM214 constitutively associates with procaspase 4 under both basal and ER stress conditions, as demonstrated by coimmunoprecipitation experiments.

  • Reciprocal Functional Requirement:

    • TMEM214-induced apoptosis is abolished by a dominant-negative mutant of procaspase 4 (C258S)

    • Caspase 4-induced apoptosis is inhibited by knockdown of TMEM214

    • Simultaneous knockdown of both TMEM214 and procaspase 4 provides enhanced protection against ER stress-induced apoptosis compared to individual knockdowns

  • Localization Dependency:

    • TMEM214 is required for procaspase 4 localization to the ER

    • The level of ER-associated procaspase 4 is dramatically decreased in TMEM214 knockdown cells

    • This localization is critical for procaspase 4 activation during ER stress

  • Activation Relationship:

    • Knockdown of TMEM214 markedly inhibits the cleavage of procaspase 4 and PARP-1 induced by ER stress

    • The N-terminal cytoplasmic region of TMEM214 (amino acids 176-354) is essential for binding procaspase 4

    • Both the procaspase 4-binding domain and ER-localization domain of TMEM214 are required for its apoptotic function

What are the methodological approaches for studying TMEM214's role in disease models?

To investigate TMEM214's role in disease models, researchers should adopt the following comprehensive approach:

  • Disease Model Selection:

    • Choose diseases with known ER stress components, such as neurodegenerative diseases (Alzheimer's, Parkinson's), diabetes, inflammatory bowel disease, or certain cancers.

    • Establish appropriate in vitro models using disease-relevant cell types (neurons, pancreatic β-cells, intestinal epithelial cells, cancer cell lines).

    • Consider in vivo models with genetic manipulations of TMEM214 expression.

  • Expression Analysis in Patient Samples:

    • Examine TMEM214 expression levels in patient-derived tissues or cells compared to healthy controls.

    • Use immunohistochemistry, Western blotting, and qRT-PCR for protein and mRNA quantification.

    • Correlate expression levels with disease severity and progression markers.

  • Functional Studies in Disease Settings:

    • Modulate TMEM214 expression (overexpression/knockdown) in disease model systems.

    • Assess the impact on ER stress markers (BiP, CHOP, XBP1 splicing) and apoptotic indicators.

    • Evaluate disease-specific endpoints (e.g., protein aggregation in neurodegenerative models, insulin secretion in diabetes models).

  • Pharmacological Interventions:

    • Test compounds that modulate ER stress (e.g., chemical chaperones, PERK inhibitors) for their effects on TMEM214-mediated pathways.

    • Develop agents that specifically target the TMEM214-procaspase 4 interaction.

    • Evaluate therapeutic potential in disease models.

How should researchers analyze contradictory data regarding TMEM214 function in different experimental systems?

When confronted with contradictory data regarding TMEM214 function across different experimental systems, researchers should implement the following analytical framework:

  • Systematic Comparison of Experimental Conditions:

    • Create a detailed comparison table of all experimental variables: cell types, expression systems, stress inducers (type, concentration, duration), detection methods, and quantification approaches.

    • Identify specific variables that correlate with divergent results.

  • Cell Type-Specific Variations:

    • Examine endogenous expression levels of TMEM214 and procaspase 4 across different cell lines.

    • The correlation between TMEM214 levels and sensitivity to TG-induced apoptosis across different cell lines (HeLa, HCT116, HepG2, A549) suggests cell-specific responses.

    • Consider differences in ER stress response machinery between cell types.

  • Technical Validation:

    • Verify antibody specificity using multiple detection methods.

    • Confirm knockdown or overexpression efficiency through several techniques.

    • Repeat critical experiments using alternative methodological approaches.

  • Pathway Connectivity Analysis:

    • Investigate the integration of TMEM214-mediated pathways with other cellular processes specific to each experimental system.

    • Consider potential compensatory mechanisms that might mask TMEM214 function in certain contexts.

    • Examine cross-talk with other apoptotic pathways that might lead to contradictory results.

What are the current technical challenges in purifying recombinant TMEM214 for structural studies?

Purifying recombinant TMEM214 for structural studies presents several technical challenges that researchers must address:

  • Transmembrane Protein Expression Challenges:

    • Expression System Selection: Mammalian expression systems are preferred over bacterial systems for proper folding and post-translational modifications of transmembrane proteins like TMEM214.

    • Fusion Tag Strategy: Consider using specialized fusion tags designed for membrane proteins (e.g., MISTIC, Fh8) in addition to conventional purification tags (His, GST).

    • Inducible Expression: Implement tetracycline-inducible or similar systems to control expression levels and minimize toxicity.

  • Solubilization and Stability Optimization:

    • Detergent Screening: Systematically test a panel of detergents (DDM, LMNG, digitonin) for optimal solubilization of TMEM214 while maintaining native structure.

    • Lipid Supplementation: Include specific lipids during purification to maintain protein stability and function.

    • Nanodiscs or Amphipols: Consider reconstitution into nanodiscs or amphipols for improved stability outside the native membrane environment.

  • Protein-Protein Interaction Preservation:

    • Co-expression Strategies: Co-express TMEM214 with binding partners like procaspase 4 to stabilize the complex.

    • Mild Purification Conditions: Optimize buffer conditions (pH, ionic strength, glycerol content) to preserve native interactions.

    • Crosslinking Approaches: Implement mild crosslinking strategies to capture transient interactions.

  • Domain-Based Purification Approach:

    • Truncated Constructs: Focus on specific domains, particularly the N-terminal cytoplasmic region (amino acids 176-354) for interaction studies.

    • Chimeric Proteins: Design chimeric constructs with soluble proteins to enhance expression and purification of the transmembrane domains.

    • Crystallization Chaperones: Incorporate antibody fragments or other crystallization chaperones to facilitate structural studies.

What are the promising research avenues for exploring TMEM214's potential role in novel therapeutic approaches?

Several promising research avenues exist for exploring TMEM214's therapeutic potential:

  • Targeting the TMEM214-Procaspase 4 Interface:

    • Develop small molecule inhibitors or peptide mimetics that disrupt the interaction between TMEM214's N-terminal domain (amino acids 176-354) and procaspase 4.

    • Design screening assays to identify compounds that selectively block this interaction without affecting other cellular functions.

    • Validate candidates in cellular models of ER stress-associated diseases.

  • Modulating TMEM214 Expression:

    • Explore RNA-based therapies (siRNA, antisense oligonucleotides) to reduce TMEM214 expression in conditions where excessive ER stress-induced apoptosis contributes to pathology.

    • Develop tissue-specific delivery systems for these modulators, particularly targeting tissues highly susceptible to ER stress damage.

    • Investigate the therapeutic window where TMEM214 inhibition prevents pathological apoptosis without compromising normal cellular function.

  • Disease-Specific Applications:

    • Neurodegenerative Disorders: Test TMEM214 inhibition strategies in models of Alzheimer's and Parkinson's disease, where ER stress contributes to neuronal death.

    • Diabetes: Investigate TMEM214's role in pancreatic β-cell apoptosis and potential interventions to preserve insulin production.

    • Inflammatory Conditions: Explore connections between TMEM214-mediated ER stress responses and inflammatory pathways in conditions like inflammatory bowel disease.

  • Combination Therapy Approaches:

    • Design therapeutic strategies combining TMEM214 modulation with other ER stress-protective interventions (chemical chaperones, PERK inhibitors).

    • Explore synergistic effects with drugs targeting parallel cell death pathways.

    • Develop predictive biomarkers to identify patients likely to benefit from TMEM214-targeted therapies.

How can advanced imaging techniques enhance our understanding of TMEM214 dynamics during ER stress?

Advanced imaging techniques offer significant potential for enhancing our understanding of TMEM214 dynamics during ER stress:

  • Live-Cell Super-Resolution Microscopy:

    • Implement techniques such as STORM, PALM, or STED microscopy to visualize TMEM214 organization at the ER membrane with nanometer resolution.

    • Track changes in TMEM214 distribution and clustering during progressive ER stress.

    • Use multi-color super-resolution to simultaneously visualize TMEM214, procaspase 4, and ER markers.

  • Single-Molecule Tracking:

    • Apply single-molecule tracking to monitor the mobility and diffusion characteristics of individual TMEM214 molecules.

    • Compare movement patterns before and after ER stress induction.

    • Correlate mobility changes with functional outcomes (apoptosis initiation).

  • FRET/FLIM Analysis:

    • Develop FRET (Förster Resonance Energy Transfer) pairs between TMEM214 and procaspase 4 to monitor their interaction dynamics in real-time.

    • Use FLIM (Fluorescence Lifetime Imaging Microscopy) to quantify interaction strength under different conditions.

    • Implement FRET-based biosensors to detect conformational changes in the TMEM214-procaspase 4 complex.

  • Correlative Light and Electron Microscopy (CLEM):

    • Combine fluorescence imaging of TMEM214 with electron microscopy to correlate its localization with ultrastructural changes in the ER during stress.

    • Implement immuno-EM approaches to precisely localize TMEM214 relative to ER subdomains.

    • Use cryo-EM tomography to visualize the three-dimensional organization of TMEM214-containing complexes.

What experimental approaches are recommended for investigating the potential role of TMEM214 in non-apoptotic cellular processes?

To investigate potential non-apoptotic roles of TMEM214, researchers should consider the following experimental approaches:

  • Unbiased Interactome Analysis:

    • Perform immunoprecipitation followed by mass spectrometry (IP-MS) to identify novel TMEM214 interaction partners beyond procaspase 4.

    • Use proximity labeling techniques (BioID, APEX) to identify proteins in the vicinity of TMEM214 under non-stress conditions.

    • Validate key interactions using orthogonal methods (co-IP, FRET, pull-down assays).

  • Transcriptome and Proteome Profiling:

    • Compare gene expression patterns in TMEM214 knockdown vs. control cells under basal (non-stress) conditions.

    • Use pathway enrichment analysis to identify cellular processes potentially regulated by TMEM214.

    • Perform targeted proteomics to quantify changes in specific pathway components.

  • Subcellular Dynamics Studies:

    • Investigate TMEM214's potential role in ER-associated processes such as protein trafficking, calcium homeostasis, and lipid metabolism.

    • Utilize fluorescent reporters to monitor these processes in cells with modulated TMEM214 expression.

    • Examine TMEM214's localization during different cell cycle stages and cellular differentiation processes.

  • Alternative Stress Response Investigations:

    • Test involvement in cellular responses to stresses beyond protein misfolding (e.g., oxidative stress, nutrient deprivation, hypoxia).

    • Assess TMEM214's potential role in autophagy, given the interplay between ER stress and autophagic pathways.

    • Investigate connections to inflammatory signaling pathways, considering previous reports of TMEM214's role in viral replication and cellular mRNA degradation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.