Recombinant Human Transmembrane protein 215 (TMEM215)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a reference.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
TMEM215; Transmembrane protein 215
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-235
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
TMEM215
Target Protein Sequence
MRPDDINPRTGLVVALVSVFLVFGFMFTVSGMKGETLGNIPLLAIGPAICLPGIAAIALA RKTEGCTKWPENELLWVRKLPCFRKPKDKEVVELLRTPSDLESGKGSSDELAKKAGLRGK PPPQSQGEVSVASSINSPTPTEEGECQSLVQNGHQEETSRYLDGYCPSGSSLTYSALDVK CSARDRSECPEPEDSIFFVPQDSIIVCSYKQNSPYDRYCCYINQIQGRWDHETIV
Uniprot No.

Target Background

Database Links

HGNC: 33816

KEGG: hsa:401498

UniGene: Hs.522063

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the physiological function of TMEM215 in vascular development?

TMEM215 plays a critical role in protecting endothelial cells (ECs) from apoptosis during vessel pruning and regression . In developmental and pathological tissues, nascent vessel networks generated by angiogenesis require further pruning to eliminate nonfunctional ECs through apoptosis and migration . TMEM215 functions as a protective factor in this process.

The protein forms a complex with BiP (binding immunoglobin protein) and facilitates the interaction between BiP and BIK (BCL-2 interacting killer), a BH3-only proapoptotic protein . By mediating this interaction, TMEM215 prevents BIK-triggered mitochondrial apoptosis that occurs through calcium influx via mitochondria-associated ER membranes (MAMs) . This protection is essential for normal vascular development, as evidenced by studies in endothelial-specific knockout mouse models showing impaired regression of retinal vasculature .

How is TMEM215 expression regulated in endothelial cells?

TMEM215 expression in endothelial cells is dynamically regulated by hemodynamic forces, particularly blood flow-derived shear stress . Research has demonstrated that:

  • Physiological laminar shear stress (LSS >8 dyne/cm²) significantly upregulates TMEM215 expression at both mRNA and protein levels in human umbilical vein endothelial cells (HUVECs) .

  • The mechanism of upregulation occurs via downregulation of EZH2 (Enhancer of zeste homolog 2) .

  • Oscillatory shear stress (OS) downregulates TMEM215 expression compared to laminar shear stress .

  • TMEM215 expression is higher in endothelial cells from vascular regions experiencing laminar blood flow (e.g., descending thoracic aorta) compared to regions with turbulent flow (e.g., aortic arch) .

  • RNA-seq data shows that Tmem215 expression in retinal ECs is dynamically expressed in a manner that negatively correlates with intrinsic apoptosis-related genes and positively correlates with shear stress response genes Klf2 and Klf4 .

This flow-dependent regulation suggests TMEM215 serves as a mechanosensitive mediator of endothelial cell survival.

What protein interactions are essential for TMEM215's anti-apoptotic function?

TMEM215's anti-apoptotic function relies on specific protein interactions within the endoplasmic reticulum . Key interactions include:

Interaction PartnerFunctionEffect of Disruption
BiP (binding immunoglobin protein)Molecular chaperoneDissociation from BIK complex, leading to increased apoptosis
BIK (BCL-2 interacting killer)BH3-only proapoptotic proteinEnhanced apoptotic signaling when not complexed with BiP
BCL-2 (B-cell lymphoma 2)Antiapoptotic proteinOverexpression rescues TMEM215 knockdown-induced apoptosis

Immunoprecipitation-mass spectrometry screening followed by immunoprecipitation assays using the TMEM215-C fragment has identified that TMEM215 associates with BiP, most likely within a protein complex . TMEM215 functions as a scaffold to assist the interaction between BIK and BiP, thereby inhibiting EC apoptosis . When TMEM215 is knocked down, the dissociation of BIK and BiP occurs, which can be visualized by immunoprecipitation and super-resolution structured illumination microscopy (SIM) .

What molecular mechanisms mediate TMEM215's prevention of endothelial cell apoptosis?

The molecular pathway through which TMEM215 prevents endothelial cell apoptosis involves several interconnected processes :

  • TMEM215 facilitates the interaction between BIK and BiP in the endoplasmic reticulum, forming a protein complex that suppresses BIK-mediated apoptotic signaling .

  • In the absence of TMEM215 (via knockdown or knockout), BiP dissociates from BIK, allowing BIK to induce apoptosis .

  • This apoptotic pathway involves regulation of mitochondria-associated ER membranes (MAMs), which are contact sites between the ER and mitochondria .

  • TMEM215 knockdown increases the number of MAMs and decreases the distance between the outer mitochondrial membrane (OMM) and ER membrane .

  • These alterations enhance calcium flux from the ER to mitochondria, which triggers the intrinsic apoptotic pathway .

  • Inhibiting mitochondrial calcium influx by blocking the IP3R (inositol 1,4,5-trisphosphate receptor) or MCU (mitochondrial calcium uniporter) abrogates TMEM215 knockdown–induced apoptosis .

  • The apoptotic effect of TMEM215 knockdown can be rescued by simultaneous BIK knockdown or BCL-2 overexpression .

This mechanism highlights TMEM215's role as a regulator of calcium-dependent apoptotic signaling at the ER-mitochondria interface.

How does TMEM215 influence mitochondria-associated ER membranes (MAMs) and calcium signaling?

TMEM215 serves as a critical regulator of MAM formation and calcium transfer between the ER and mitochondria :

  • MAMs are specialized contact sites between the ER and mitochondria that facilitate calcium transfer and lipid exchange .

  • TMEM215 knockdown in endothelial cells leads to:

    • Increased number of MAMs

    • Decreased distance between the outer mitochondrial membrane and ER membrane

    • Enhanced calcium flux from ER to mitochondria

  • These alterations in MAM structure and function are BIK-dependent, as simultaneous knockdown of BIK rescues the MAM phenotype induced by TMEM215 depletion .

  • The increased mitochondrial calcium influx resulting from TMEM215 knockdown can be measured using calcium imaging techniques .

  • Pharmacological inhibition of calcium channels including IP3R or MCU prevents TMEM215 knockdown-induced apoptosis, confirming the causative role of calcium dysregulation in this process .

For researchers investigating this pathway, calcium imaging techniques and transmission electron microscopy (TEM) for visualizing MAMs are valuable methodological approaches to quantify these phenotypes .

What are the vascular phenotypes observed in TMEM215 knockout animal models?

Endothelial cell-specific conditional knockout of Tmem215 in mice reveals distinct vascular phenotypes that highlight its physiological importance :

  • In developing retinal vasculature:

    • Reduced number of vessel branches

    • Increased vessel regression in the superficial plexus

    • Increased empty basement membrane sleeves (indicating regressed vessels)

    • Increased endothelial cell apoptosis

  • At the subcellular level, retinal endothelial cells from Tmem215 knockout mice show:

    • Decreased colocalization of BiP and BIK

    • Increased number of ER-mitochondria contacts

    • Decreased distance between outer mitochondrial membrane and ER membrane

  • In tumor models, EC-specific Tmem215 ablation:

    • Inhibits tumor growth

    • Results in disrupted tumor vasculature

  • In adult mice, Tmem215 ablation:

    • Attenuates lung metastasis

    • Reduces Vcam1 expression

  • Regarding other organs, EC-specific Tmem215 knockout mice show:

    • Normal gross morphology in liver, kidney, spleen, and lung

    • Halted follicle development in ovary, consistent with impaired angiogenesis

These findings suggest that TMEM215 primarily affects angiogenic (actively growing) rather than quiescent endothelial cells, making it a potential therapeutic target for conditions involving pathological angiogenesis .

What experimental approaches are used to manipulate TMEM215 expression in vitro and in vivo?

Several methodologies have been developed to modulate TMEM215 expression for research purposes :

In vitro approaches:

  • RNA interference:

    • Short hairpin RNA (shRNA) for stable knockdown

    • Small interfering RNA (siRNA) for transient knockdown

  • Recombinant protein expression:

    • Expression of full-length TMEM215 with various tags (His, Myc/DDK)

    • Fragment-specific expression to study domain functions

  • Flow simulation:

    • ibidi apparatus for applying laminar or oscillatory shear stress to cultured endothelial cells

In vivo approaches:

  • Conditional knockout mouse models:

    • Endothelial cell-specific Tmem215 knockout using Cre-loxP system

    • Inducible knockouts using tamoxifen-inducible Cre (e.g., Cdh5-CreERT2)

  • Nanoparticle-delivered siRNA:

    • Polyethyleneimine-polyethylene glycol functionalized with cyclic Arg-Gly-Asp-D-Phe-Lys peptide (PEI-PEG-cRGD)

    • Specifically targets integrin αVβ3 on activated endothelial cells

    • Demonstrated efficacy in tumor and choroidal neovascularization models

The nanoparticle delivery system has been extensively characterized using nuclear magnetic resonance (NMR), scanning electron microscopy, and ZETA potential analysis, with favorable toxicity profiles in both cellular and animal models .

How can TMEM215 be targeted for potential therapeutic applications?

TMEM215 represents a promising target for antiangiogenic therapies based on several experimental findings :

  • Tumor models:

    • EC-specific genetic ablation of Tmem215 inhibits tumor growth with disrupted vasculature

    • Administration of nanoparticles carrying Tmem215 siRNA inhibits tumor growth

  • Ocular neovascularization:

    • Nanoparticle-delivered Tmem215 siRNA shows efficacy in choroidal neovascularization models, suggesting potential applications for age-related macular degeneration

  • Metastasis:

    • Tmem215 ablation in adult mice attenuates lung metastasis, linked to reduced Vcam1 expression

  • Delivery strategies:

    • Nanoparticles using PEI-PEG-cRGD specifically target activated endothelial cells via integrin αVβ3

    • This approach shows low toxicity in various assays, including cell viability tests, hemolysis assays, and blood biochemistry analysis

The differential effect of TMEM215 on angiogenic versus quiescent endothelial cells makes it particularly attractive as a therapeutic target, as it may allow for specific targeting of pathological angiogenesis while sparing normal vasculature .

What are the optimal methods for detecting and analyzing TMEM215 expression and function?

Researchers have employed various techniques to study TMEM215 expression, localization, and function :

Expression analysis:

  • Quantitative real-time PCR for mRNA expression

  • Western blotting for protein expression

  • RNA-seq for transcriptome-wide analysis

Protein interaction studies:

  • Immunoprecipitation-mass spectrometry for identifying interaction partners

  • Co-immunoprecipitation for validating specific protein interactions

  • Super-resolution structured illumination microscopy (SIM) for visualizing protein colocalization

Subcellular localization:

  • Immunofluorescence microscopy

  • Transmission electron microscopy (TEM) for visualizing MAMs

  • Subcellular fractionation

Functional assays:

  • Apoptosis assays:

    • TUNEL (Terminal deoxynucleotidyl transferase dUTP Nick End Labeling)

    • Annexin V/PI staining

    • Caspase activity assays

  • Calcium flux measurements:

    • Calcium imaging using fluorescent indicators

    • Mitochondrial calcium uptake assays

  • Vascular phenotype analysis:

    • Isolectin B4 staining for visualizing blood vessels

    • Collagen IV staining for basement membrane sleeves

    • Vessel branch counting and regression analysis

When working with recombinant TMEM215 protein, appropriate storage and handling are essential: store at -20°C/-80°C, avoid repeated freeze-thaw cycles, and reconstitute lyophilized protein in deionized sterile water with 5-50% glycerol for long-term storage .

What controls should be included when studying TMEM215-mediated pathways?

When investigating TMEM215 function, several controls are essential to ensure experimental validity :

  • For knockdown experiments:

    • Non-targeting siRNA/shRNA controls

    • Rescue experiments with TMEM215 overexpression

    • Simultaneous knockdown of downstream effectors (e.g., BIK) to confirm pathway specificity

  • For protein interaction studies:

    • IgG controls for immunoprecipitation

    • Fragment-specific constructs to map interaction domains

    • Competition assays to validate direct interactions

  • For calcium signaling:

    • Pharmacological controls (IP3R or MCU inhibitors)

    • Calcium-free conditions

    • Mitochondrial uncouplers as negative controls

  • For in vivo experiments:

    • Cre-negative littermates as controls for conditional knockout models

    • Scrambled siRNA-loaded nanoparticles for delivery experiments

    • Tissue-specific controls (e.g., comparing affected vs. unaffected vascular beds)

  • For shear stress experiments:

    • Static culture conditions as baseline

    • Different flow patterns (laminar vs. oscillatory)

    • Time course analyses to capture dynamic responses

How does the function of TMEM215 differ between developmental and pathological contexts?

TMEM215 exhibits context-dependent functions that vary between developmental processes and pathological conditions :

Developmental contexts:

  • Retinal vascular development:

    • TMEM215 protects endothelial cells from excessive apoptosis

    • EC-specific knockout results in increased vessel regression

    • Required for normal vascular plexus formation

  • Ovarian development:

    • TMEM215 deficiency leads to halted follicle development

    • Consistent with impaired angiogenesis in reproductive organs

Pathological contexts:

  • Tumor angiogenesis:

    • TMEM215 inhibition disrupts tumor vasculature

    • Results in decreased tumor growth

    • Potential therapeutic target for cancer treatment

  • Metastasis:

    • TMEM215 ablation attenuates lung metastasis

    • Associated with reduced VCAM1 expression

    • Suggests potential anti-metastatic applications

  • Ocular neovascularization:

    • Targeting TMEM215 inhibits choroidal neovascularization

    • Relevant for conditions like age-related macular degeneration

This differential effect appears related to the activation state of endothelial cells. TMEM215 deficiency primarily affects angiogenic (actively growing) endothelial cells while quiescent endothelial cells in most adult organs are less dependent on TMEM215 for survival . This selective requirement makes TMEM215 an attractive therapeutic target with potentially limited side effects on normal vasculature.

What are the challenges in translating TMEM215 research from in vitro to in vivo models?

Translating TMEM215 research from cellular models to animal studies presents several challenges that researchers should consider :

  • Cell-type specificity:

    • TMEM215 function may vary between different endothelial cell types

    • In vitro studies often use HUVECs, which may not fully represent all vascular beds

    • Organ-specific endothelial cells should be considered for validation

  • Activation state discrepancies:

    • In vitro cultured endothelial cells are typically more activated than quiescent cells in vivo

    • This may exaggerate TMEM215-dependent phenotypes

    • Strategies to match activation states should be employed

  • Flow conditions:

    • In vitro flow systems cannot fully recapitulate the complex hemodynamics of living vasculature

    • Integration of in vitro flow studies with in vivo flow mapping is recommended

  • Compensatory mechanisms:

    • Long-term genetic deletion may trigger compensatory pathways not observed in acute knockdown

    • RNA-seq of quiescent lung ECs from Tmem215 knockout mice showed substantial changes in gene expression profiles

    • These compensatory changes may mask or alter phenotypes

  • Delivery challenges:

    • Targeted delivery to specific vascular beds remains challenging

    • While nanoparticle approaches show promise, optimization for specific applications is needed

    • Considerations include biodistribution, clearance, and accumulation in non-target tissues

Understanding these challenges is essential for proper experimental design and interpretation of results when studying TMEM215 in different research contexts.

How can researchers reconcile conflicting data about TMEM215 function?

When confronted with contradictory findings regarding TMEM215 function, researchers should consider several factors that might explain discrepancies :

  • Endothelial cell heterogeneity:

    • Endothelial cells from different vascular beds have distinct transcriptional profiles

    • TMEM215 function may vary between arterial, venous, and capillary endothelial cells

    • Source of endothelial cells should be considered when comparing results

  • Temporal dynamics:

    • TMEM215 expression changes dynamically during development

    • Timing of genetic manipulation may yield different phenotypes

    • Developmental stage-specific effects should be considered

  • Knockdown versus knockout discrepancies:

    • Acute (siRNA) versus chronic (genetic) depletion may trigger different responses

    • Complete absence versus partial reduction may activate different pathways

    • Dose-dependent effects should be characterized

  • Flow conditions:

    • TMEM215 is flow-responsive, so experimental flow conditions are critical

    • In vivo flow patterns vary between vascular beds and developmental stages

    • Flow profiles should be matched when comparing results

  • Context-dependent functions:

    • TMEM215 primarily affects angiogenic rather than quiescent endothelial cells

    • Experimental contexts (developmental, tumor, inflammation) may yield different outcomes

    • Multiple models should be used to validate findings

  • Technical considerations:

    • Antibody specificity for TMEM215 detection

    • Efficiency of genetic manipulation approaches

    • Methods used to assess phenotypes (e.g., apoptosis detection)

When publishing or interpreting TMEM215 research, these factors should be explicitly addressed to facilitate comparison between studies and advance understanding of this protein's complex biology.

What future research directions might advance our understanding of TMEM215 biology?

Several promising research directions could significantly expand our knowledge of TMEM215 biology and its therapeutic potential :

  • Structural biology:

    • Determination of TMEM215's three-dimensional structure

    • Mapping of interaction domains with BiP and BIK

    • Structure-based drug design targeting TMEM215 complexes

  • System-specific functions:

    • Investigation of TMEM215 in specialized vascular beds (blood-brain barrier, kidney glomeruli)

    • Role in lymphatic vessel development and function

    • Potential functions in non-endothelial cells

  • Pathological relevance:

    • TMEM215 expression in human vascular diseases (atherosclerosis, diabetic retinopathy)

    • Correlation with disease progression and outcomes

    • Genetic variants and their functional consequences

  • Therapeutic optimization:

    • Development of small molecule modulators of TMEM215 function

    • Improvement of targeted delivery systems for tissue-specific intervention

    • Combination approaches with existing antiangiogenic therapies

  • Mechanistic expansion:

    • Investigation of other downstream targets beyond BIK

    • Integration with other endothelial cell survival pathways

    • Exploration of non-apoptotic functions

  • Regulation mechanisms:

    • Epigenetic control of TMEM215 expression

    • Post-translational modifications affecting function

    • Identification of additional transcriptional regulators beyond EZH2

These research directions hold potential for translating basic insights about TMEM215 biology into clinically relevant applications for vascular diseases and cancer.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.