Recombinant Human Transmembrane protein 216 (TMEM216)

Shipped with Ice Packs
In Stock

Description

Expression and Purification Challenges

Native TMEM216 is notoriously difficult to express due to its hydrophobic transmembrane regions and low solubility. Common strategies for recombinant production include:

Expression SystemAdvantagesLimitations
Mammalian Cells (HEK293, CHO)Proper folding and post-translational modificationsLow yield; high cost
Insect Cells (Sf9/Baculovirus)Higher yield than mammalian systemsLimited scalability
E. coliCost-effectiveMisfolding; lacks glycosylation
Cell-Free SystemsBypasses membrane integration issuesLimited commercial availability

Source: Adapted from transmembrane protein expression challenges .

Purification typically requires detergents (e.g., DDM, CHAPS) or nanodiscs to stabilize the protein . Beta LifeScience’s platforms (VLP, CFPS) highlight industry advancements in overcoming these barriers .

Disease Modeling

  • Joubert Syndrome: TMEM216 mutations (e.g., p.R73L, p.R85X) disrupt ciliogenesis, leading to cerebellar hypoplasia and renal cysts . Recombinant TMEM216 could enable functional rescue studies.

  • Retinitis Pigmentosa: Zebrafish models show TMEM216 deletion causes photoreceptor degeneration and opsin mislocalization .

Drug Discovery

  • Hh Pathway Targeting: TMEM216’s role in GLI2/GLI3 processing makes it a candidate for cancers driven by aberrant Hh signaling .

  • Antibody Development: Boster Bio validates antibodies against TMEM216 for research and diagnostic use .

Key Mutations and Clinical Relevance

MutationPhenotypeMechanismSource
p.R73L (c.218G>T)JBTS2, MKS2Disrupts ciliary transition zone assembly
p.R85XCiliogenesis failurePremature truncation; loss of protein function
c.-69G>T (promoter)Retinitis pigmentosaReduces TMEM216 expression

Future Directions

  • Structural Studies: Cryo-EM of recombinant TMEM216 could elucidate its interaction with Meckelin and tectonic complex proteins .

  • Therapeutic Delivery: Adeno-associated virus (AAV)-mediated TMEM216 gene therapy is a potential avenue for ciliopathies .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have any specific format requirements, please indicate them in your order notes, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery time estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
TMEM216; HSPC244; Transmembrane protein 216
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-145
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
TMEM216
Target Protein Sequence
MLPRGLKMAPRGKRLSSTPLEILFFLNGWYNATYFLLELFIFLYKGVLLPYPTANLVLDV VMLLLYLGIEVIRLFFGTKGNLCQRKMPLSISVALTFPSAMMASYYLLLQTYVLRLEAIM NGILLFFCGSELLLEVLTLAAFSRI
Uniprot No.

Target Background

Function
TMEM216 plays a crucial role in the tectonic-like complex, which is essential for tissue-specific ciliogenesis. It may also regulate the composition of the ciliary membrane.
Gene References Into Functions
  1. Studies indicate that mutations in either TMEM138 or TMEM216 lead to a phenotypically indistinguishable ciliopathy known as Joubert syndrome. The expression of these genes is controlled by a conserved regulatory element located in the noncoding intergenic region. PMID: 22282472
  2. Research data reveals that a single G218T mutation (R73L in the protein) was identified in all cases of Ashkenazi Jewish descent. PMID: 20512146
  3. A TMEM216 mutation may contribute to Joubert syndrome 2 (JBTS2) in Ashkenazi Jews. PMID: 20036350
Database Links

HGNC: 25018

OMIM: 603194

KEGG: hsa:51259

STRING: 9606.ENSP00000440638

UniGene: Hs.26745

Involvement In Disease
Joubert syndrome 2 (JBTS2); Meckel syndrome 2 (MKS2)
Subcellular Location
Membrane; Multi-pass membrane protein. Cytoplasm, cytoskeleton, cilium basal body. Note=Localizes at the transition zone, a region between the basal body and the ciliary axoneme.

Q&A

What is the molecular structure of TMEM216 and where is it localized in cells?

TMEM216 is an uncharacterized tetraspan transmembrane protein consisting of 148 amino acids with a predicted molecular weight of approximately 19 kDa. Immunostaining experiments with anti-TMEM216 polyclonal antibodies have demonstrated that TMEM216 localizes primarily to the base of primary cilia or adjacent basal body in ciliated cells, as confirmed by co-localization with acetylated and glutamylated tubulin markers . TMEM216 is also part of the transition zone tectonic complex that regulates ciliary membrane composition . The protein shows strong reactivity at the base of cilia in organs containing ciliated cells, such as the kidney, and epitope-tagged TMEM216 demonstrates similar localization patterns .

What are the expression patterns of TMEM216 during development and in adult tissues?

In situ hybridization analysis in human embryos has revealed that TMEM216 is expressed in multiple developing tissues including the central nervous system, limb bud, kidney, and cartilage . This expression pattern is similar to other genes associated with Joubert syndrome and Meckel syndrome, showing a broad and relatively low-level expression across tissues. In zebrafish models, TMEM216 shows wide expression distribution in multiple organs including the eye, pronephros, brain, liver, intestine, and muscle at 3 days post-fertilization (dpf) . Within the retina specifically, TMEM216 expression is observed in all cell layers including the outer nuclear layer, inner nuclear layer, and ganglion cell layer, and this expression is maintained at 7 dpf . RT-PCR studies confirm TMEM216 mRNA expression in freshly laid eggs, larvae at 7 dpf, and adult tissues including eye, brain, and skeletal muscle .

What is the role of TMEM216 in ciliogenesis and cellular function?

TMEM216 plays a critical role in ciliogenesis and proper ciliary function. Fibroblasts from patients with homozygous TMEM216 p.R85X mutations show defective ciliogenesis following 48 hours of serum starvation compared to control cells . Similarly, siRNA knockdown of TMEM216 in polarized IMCD3 cells prevents ciliogenesis and blocks correct docking of centrosomes at the apical cell surface, a phenotype quantified by measuring the percentage of cells with cilia and analyzing the percentage of cells with centrosomes located apical to the nucleus . These findings suggest TMEM216 is required for centrosome docking, a critical early step in ciliogenesis. Additionally, TMEM216 forms protein complexes with Meckelin (encoded by MKS3/TMEM67), as demonstrated by co-immunoprecipitation experiments, suggesting functional interactions between these proteins in ciliary processes .

How does TMEM216 interact with signaling pathways relevant to ciliopathies?

TMEM216 modulates multiple signaling pathways critical for ciliary function and embryonic development. Loss of TMEM216 leads to hyperactivation of RhoA and increased phosphorylation of Dishevelled 1 (Dvl1), suggesting that TMEM216 normally functions to suppress these pathways . Interestingly, Rho inhibition blocks the constitutive Dvl1 phosphorylation associated with TMEM216 loss, indicating a feedback mechanism between Rho and Dvl . This interaction is significant as both RhoA and Dvl are involved in actin-dependent polarized cell behavior and morphogenetic cell movements. The hyperactivation of these pathways may contribute to the developmental abnormalities observed in ciliopathies caused by TMEM216 mutations. Researchers investigating these interactions should consider employing RhoA activity assays, phosphorylation-specific antibodies for Dvl, and small molecule inhibitors of these pathways to delineate the exact mechanisms linking TMEM216 to Rho/Dvl signaling.

What are the differences in phenotypes between partial and complete loss of TMEM216 function?

The phenotypic spectrum associated with TMEM216 mutations ranges from the relatively milder Joubert syndrome to the more severe and lethal Meckel syndrome, suggesting a correlation between the degree of TMEM216 dysfunction and clinical severity . In human patients, a single p.R73L mutation in TMEM216 was identified in all patients of Ashkenazi Jewish descent with Joubert syndrome, while more severe truncating mutations were associated with Meckel syndrome . In experimental models, complete knockout of TMEM216 in zebrafish results in early lethality (before 21 days post-fertilization) with severe photoreceptor degeneration, disrupted ciliary axoneme formation, and mislocalization of outer segment proteins . These animals exhibit shortened photoreceptor ciliary axoneme and abnormal disc morphology in the outer segments . Researchers studying TMEM216 should consider using both knockdown approaches (which may allow partial function) and complete knockout models to explore the full spectrum of phenotypes and determine threshold levels of TMEM216 function required for normal development.

How does TMEM216 function within the tectonic complex at the ciliary transition zone?

TMEM216 is a member of the transition zone tectonic complex, which consists of multiple proteins associated with Meckel and Joubert syndromes, including secreted protein TCTN1, transmembrane proteins TCTN2, TCTN3, meckelin (TMEM67), and intracellular proteins B9D1, CEP290, MKS-1, and CC2D2A . This complex functions at the ciliary transition zone to regulate cilia formation and control the localization of ciliary membrane proteins . TMEM216 directly interacts with Meckelin as demonstrated by co-immunoprecipitation studies . The tectonic/B9 complex is involved in cilia formation, regulates localization of ciliary membrane proteins such as Arl13b, and limits plasma membrane proteins in cilia . Research approaches to study these interactions should include proximity labeling techniques, interaction mapping using truncated constructs, and high-resolution imaging of the transition zone to understand the architectural organization of these protein complexes.

What are the most effective methods for generating and validating recombinant TMEM216?

To generate recombinant TMEM216 for research purposes, researchers should consider:

  • Expression Systems: Bacterial expression systems may be suitable for studying protein fragments, but mammalian systems are recommended for full-length TMEM216 to ensure proper membrane insertion and post-translational modifications.

  • Purification Approaches: Given TMEM216's transmembrane nature, solubilization with mild detergents or nanodiscs is crucial for maintaining native conformation during purification.

  • Validation Methods:

    • Western blotting with specific antibodies (such as those raised against aa 81-90 of TMEM216)

    • Localization studies in ciliated cells to confirm proper subcellular targeting

    • Functional rescue experiments in TMEM216-deficient cell lines or animal models

  • Tags and Constructs: Epitope tags should be carefully positioned to avoid disrupting membrane topology or protein interactions. C-terminal tagging may be preferable as N-terminal sequences often contain trafficking information.

Researchers should validate recombinant TMEM216 function through complementation studies in TMEM216-deficient cells, assessing restoration of ciliogenesis, centrosome docking, and normalization of RhoA and Dvl1 activity levels .

What experimental models are most suitable for studying TMEM216 function?

Several experimental models have proven valuable for studying TMEM216 function:

  • Cellular Models:

    • IMCD3 (inner medullary collecting duct) and hRPE (human retinal pigment epithelium) cell lines are well-established models for studying ciliary proteins including TMEM216

    • Patient-derived fibroblasts with TMEM216 mutations provide relevant disease models

    • siRNA knockdown approaches in polarized epithelial cells allow for analysis of ciliogenesis defects

  • Animal Models:

    • CRISPR/Cas9-generated TMEM216 knockout zebrafish provide a valuable vertebrate model for studying TMEM216 function in multiple tissues, particularly in photoreceptors

    • The zebrafish model is especially useful because:

      • Transparent embryos allow for in vivo imaging

      • Rapid development enables efficient phenotypic analysis

      • TMEM216 knockout fish exhibit clear phenotypes including photoreceptor degeneration and abnormal outer segment formation

  • Advantages and Limitations:

    • Cellular models allow for detailed mechanistic studies but lack the developmental and tissue context

    • Zebrafish models enable in vivo analysis but early lethality (before 21 dpf) may limit studies of later phenotypes

    • Mouse models would be valuable but may face similar early lethality challenges as seen with other transition zone proteins

What techniques are most effective for analyzing TMEM216 interactions with other proteins?

To study TMEM216 protein interactions, researchers should consider:

  • Co-immunoprecipitation approaches: Successfully used to demonstrate interaction between TMEM216 and Meckelin. Both GFP-tagged TMEM216 immunoprecipitation with antibodies to Meckelin and the reciprocal approach have confirmed this interaction .

  • Proximity labeling methods: BioID or APEX2 fusion proteins can identify proteins in close proximity to TMEM216 in living cells, which is particularly valuable for membrane proteins with potentially transient interactions.

  • Fluorescence-based interaction assays: FRET (Förster Resonance Energy Transfer) or BiFC (Bimolecular Fluorescence Complementation) can detect protein interactions in living cells with spatial resolution.

  • Mass spectrometry analysis: After crosslinking and immunoprecipitation, mass spectrometry can identify novel TMEM216 interacting partners within the tectonic complex and beyond.

  • Yeast two-hybrid membrane systems: Modified to accommodate transmembrane proteins, these systems can screen for direct protein interactions.

When designing interaction studies, researchers should consider the transmembrane nature of TMEM216 and ensure that protein folding and membrane topology are preserved during experimental manipulations.

How do specific TMEM216 mutations correlate with ciliopathy phenotypes?

TMEM216 mutations cause a spectrum of ciliopathies ranging from Joubert syndrome to the more severe Meckel syndrome. Specific genotype-phenotype correlations include:

  • Mutation type and location:

    • The p.R73L (c.218G>T) mutation is particularly prevalent in patients of Ashkenazi Jewish descent with Joubert syndrome

    • More severe truncating mutations like p.R85X are associated with the lethal Meckel syndrome phenotype

  • Clinical manifestations:

    • JBTS2 patients with TMEM216 mutations frequently display nephronophthisis and polydactyly

    • Some cases conform to the Oro-Facio-Digital type VI phenotype

    • MKS fetuses commonly present with skeletal dysplasia

    • Photoreceptor degeneration is a prominent phenotype in Joubert syndrome patients with TMEM216 mutations

  • Cellular phenotypes:

    • Patient fibroblasts with homozygous TMEM216 p.R85X mutations show defective ciliogenesis

    • TMEM216 knockout in zebrafish leads to shortened photoreceptor ciliary axoneme, mislocalization of outer segment proteins, and photoreceptor degeneration

Understanding these correlations is critical for genetic counseling and for developing targeted therapeutic approaches for different ciliopathy subtypes associated with TMEM216 dysfunction.

What approaches can be used to rescue phenotypes associated with TMEM216 mutations?

Several approaches hold promise for rescuing phenotypes associated with TMEM216 mutations:

  • Gene therapy approaches:

    • AAV-mediated delivery of functional TMEM216 could potentially rescue ciliary defects in affected tissues

    • The relatively small size of TMEM216 (148 amino acids) makes it amenable to packaging in viral vectors

  • Small molecule interventions:

    • Given that TMEM216 loss leads to hyperactivation of RhoA and Dishevelled signaling, Rho kinase inhibitors might ameliorate some disease phenotypes

    • Targeting downstream effectors in affected signaling pathways represents a promising approach

  • Protein replacement therapy:

    • For mutations affecting protein stability rather than function, chemical chaperones might stabilize mutant TMEM216 proteins

  • Phenotype-specific approaches:

    • For retinal degeneration phenotypes, neuroprotective agents might preserve photoreceptor function even without addressing the primary ciliary defect

Researchers should evaluate these approaches in cellular and animal models of TMEM216 deficiency, prioritizing tissue-specific delivery methods to target the most severely affected organs in ciliopathy patients.

What are the critical unanswered questions about TMEM216 function in ciliary biology?

Several important questions about TMEM216 remain unanswered:

  • Precise molecular function: How does TMEM216 contribute to centrosome docking and ciliogenesis at the molecular level? Does it function as a structural component, signaling regulator, or both?

  • Tissue-specific roles: Why do TMEM216 mutations particularly affect certain tissues (brain, kidney, retina) despite broad expression patterns?

  • Interaction with signaling pathways: What is the exact mechanism by which TMEM216 modulates RhoA and Dishevelled activity, and are there other signaling pathways affected?

  • Developmental dynamics: How does TMEM216 function change during development, and what are the critical periods when its function is most essential?

  • Relationship to other transition zone proteins: Is there functional redundancy between TMEM216 and other tectonic complex proteins that might explain phenotypic variability?

Addressing these questions will require integrating advanced imaging, proteomics, and developmental biology approaches in relevant model systems.

What emerging technologies might advance our understanding of TMEM216 biology?

Several cutting-edge technologies hold promise for advancing TMEM216 research:

  • Cryo-electron microscopy: Could reveal the structure of TMEM216 and its arrangement within the transition zone complex

  • Super-resolution microscopy: Techniques like STORM or PALM could provide detailed visualization of TMEM216 localization relative to other transition zone components

  • In situ protein interaction mapping: Proximity labeling combined with proteomics could map the protein interaction network of TMEM216 in different cell types and developmental stages

  • Single-cell transcriptomics: Could reveal how TMEM216 expression is regulated across different cell types and in response to developmental or environmental cues

  • Organoid models: Human organoids derived from patient iPSCs could provide more physiologically relevant models of TMEM216 dysfunction in affected tissues

  • CRISPR base editing: Could be used to create precise disease-associated mutations in model systems for detailed phenotypic analysis

These technologies, applied to appropriate model systems, have the potential to significantly advance our understanding of TMEM216 biology and its role in ciliopathies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.