Recombinant Human Transmembrane protein 221 (TMEM221)

Shipped with Ice Packs
In Stock

Description

Gene Properties

PropertyValue
Chromosomal Location19p13.11 (minus strand)
Gene Length13,159 base pairs
Exons3 (with a 2,301 bp longest transcript)
Promoter Region2016 bp (contains binding sites for BRNF, KLFS, LHXF, etc.)
Tissue ExpressionHigh in brain, adrenal gland, ovaries; reduced in ovarian cancer

Protein Structure

FeatureDescription
Length291 amino acids (canonical isoform); 232 amino acids (X1 isoform)
Transmembrane Domains4 (canonical), 1 (X1 isoform)
Molecular Weight~30 kDa
Isoelectric Point (pI)8.6
Post-Translational ModificationsPalmitoylation, phosphorylation, glycation, SUMOylation
Subcellular LocalizationEndoplasmic reticulum, mitochondria, plasma membrane

The TMEM221 protein contains conserved motifs Jiraiya (linked to BMP signaling attenuation) and DUF5408 (uncharacterized) .

Production Overview

Recombinant TMEM221 is typically produced in HEK293T cells with C-Myc/DDK tags for purification and detection . Key production parameters include:

ParameterDetails
Expression HostHEK293T cells
Tag SystemC-Myc/DDK (facilitates Western blot and immunoprecipitation)
Purity>80% (SDS-PAGE validation)
Storage-80°C (lyophilized or in buffer)

Functional Applications

  • Antibody Production: Used as an immunogen for generating anti-TMEM221 antibodies .

  • Cellular Assays: Studied for roles in membrane trafficking, signaling pathways, and disease mechanisms .

Biological and Pathway Links

TMEM221 exhibits functional associations across multiple biological categories:

CategoryExamples
Molecular ProfilesMicroRNA targets (e.g., miR-145, miR-30a)
Cellular ProcessesBMP signaling, ER stress response, membrane organization
Disease LinksReduced expression in ovarian cancer; potential roles in chemoresistance

While TMEM221’s direct role in diseases remains unclear, its family members (e.g., TMEM139) are implicated in pancreatic cancer via regulation of ERK-RPS6K pathways .

Tissue-Specific Expression

TissueExpression Level
BrainHigh
Adrenal GlandHigh
OvariesHigh (downregulated in ovarian cancer)
Lymphomas/Bone CancersReduced

Transcriptional Regulation

The TMEM221 promoter binds transcription factors like BRNF, KLFS, and CTCF . Regulatory elements include splice enhancers and DNAse hypersensitivity sites .

Research Challenges and Future Directions

  • Functional Elucidation: TMEM221’s exact biological role remains ambiguous, necessitating targeted knockout studies.

  • Cancer Implications: Exploration of TMEM221 in drug resistance or metastasis, leveraging its recombinant form for high-throughput screening .

  • Structural Analysis: Resolution of its tertiary structure to identify interaction partners or therapeutic targets.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format readily available in our inventory. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is discouraged. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors such as storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
TMEM221; Transmembrane protein 221
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-230
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
TMEM221
Target Protein Sequence
MARSYGGRVLAAMTLLGIAAAVLAALGAQLLFQLQAGRAELRGLRAEGLGQELGAGPGLP EDAAGTLLPLAAALAALVLVLGFTCLLLAALCGHLGAELARGPGPRRSDWFLYDCRLLRH VALGLFCCGISVYLAALSIYALLLFEIETGAAAASILGSGTLVLVAVLTHTLLRAARAAR RGLHELSPPSFEDDLARPAEVSKASPRAQPQQGIHRRTPYSTCPEPGDPF
Uniprot No.

Target Background

Database Links

HGNC: 21943

KEGG: hsa:100130519

UniGene: Hs.436603

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is TMEM221 and where is it located in the human genome?

TMEM221 (Transmembrane protein 221) is a protein encoded by the TMEM221 gene in humans. The function of this protein is currently not well understood by the scientific community. The TMEM221 gene spans 13,159 base pairs, contains three exons, and is located on the short arm of chromosome 19 at position 19p13.11. Specifically, it spans from position 17,435,509 to 17,448,668 on the minus strand. The gene is flanked by MVB12A upstream and by AC010319.5 and NXNL1 downstream .

What is known about the promoter region of TMEM221?

The predicted promoter region of TMEM221 (designated as GXP_1485843) is 2016 base pairs long and extends into the beginning of the second exon. Multiple transcription factors have been identified that potentially bind to this promoter region with varying degrees of affinity, as shown in the table below :

Transcription FactorDetailed Matrix InformationAnchor BaseMatrix SimilaritySequence
BRNFBrn POU domain factors110.905caaccatTAATctacttct
KLFSKrueppel like transcription factor450.939gggggaatggGGAGtggct
LHXFLim homeodomain factors1560.931taaaatgaTTAAttttatgttat
HOXFParalog hox genes 1-8 from the four hox clusters A, B, C, D2100.899gcgaaTAATttgggggacc
CTCFCTCF and BORIS gene family2560.813cgttgcttcctctaggaGGCTagggag
PBXCPre B-cell leukemia homeobox 34031.000agcctgagTGACagagc
NKRFNuclear factor-kappaB repressing factor5900.854aacTCCTgggc
LEFFT-cell specific HMG-box transcription factor 77010.879actccatCAAAaaaaaa
CEBPCcaat/Enhancer Binding Protein7440.941gcagtggtGCAAtct
HNFPHistone nuclear factor P7630.843ggCGGAggttgcagtgagc
CARTCart-1 (cartilage homeoprotein 1)8540.862cgggcTAATtttttttttttt
TF2BRNA polymerase II transcription factor II B9871.000ccgCGCC

What are the common methods to detect TMEM221 expression in tissue samples?

For detecting TMEM221 expression in tissue samples, researchers typically employ techniques such as quantitative PCR (qPCR), western blotting, and immunohistochemistry. For qPCR analysis, primers should be designed to target unique regions of the TMEM221 transcript, especially spanning exon-exon junctions to avoid genomic DNA amplification. When using western blotting, antibodies specific to TMEM221 should be validated for specificity using positive and negative controls. For immunohistochemistry, tissue fixation and antigen retrieval protocols may need optimization, as transmembrane proteins can be challenging to detect due to their hydrophobic domains and potential membrane embedding.

What gene editing approaches are most effective for studying TMEM221 function?

CRISPR-Cas9 gene editing technology offers a powerful approach for studying TMEM221 function. Specifically, AAV vector-based CRISPR systems with saCas9 (Staphylococcus aureus Cas9) are available for TMEM221 gene knockout studies in human cells. These systems include a set of three sgRNA targets designed to guide Cas9 to cleave exonic genomic DNA, resulting in frameshift mutations that ultimately lead to gene knockout .

To implement this approach:

  • Select the appropriate vector system based on your cell type and experimental goals

  • Transduce target cells with the CRISPR-Cas9 AAV vectors

  • Validate gene editing efficiency through sequencing

  • Confirm protein knockout through western blotting

  • Perform functional assays to assess the impact of TMEM221 deletion

For experiments requiring temporal control over gene expression, inducible CRISPR systems may be preferable. Alternatively, for structure-function studies, precise editing to introduce specific mutations rather than complete knockout may be more informative.

How can researchers distinguish between direct and indirect effects of TMEM221 manipulation in functional studies?

Distinguishing between direct and indirect effects of TMEM221 manipulation requires multiple complementary approaches:

  • Time-course analysis: Monitor changes immediately following TMEM221 manipulation to identify primary effects, as secondary effects typically occur after a delay.

  • Rescue experiments: Re-introduce wild-type TMEM221 into knockout cells to confirm that observed phenotypes are directly caused by TMEM221 absence.

  • Domain-specific mutations: Create mutations in specific protein domains to identify which regions are responsible for particular functions.

  • Interaction studies: Perform co-immunoprecipitation or proximity labeling to identify direct protein binding partners of TMEM221.

  • Subcellular localization: Use fluorescently tagged TMEM221 to track its localization and co-localization with potential interacting proteins.

  • Transcriptomics and proteomics: Compare gene expression and protein abundance changes between control and TMEM221-manipulated samples at multiple time points to establish causality chains.

What are the optimal conditions for recombinant TMEM221 protein expression?

Expressing recombinant transmembrane proteins like TMEM221 presents unique challenges due to their hydrophobic domains. The following optimized approach is recommended:

  • Expression system selection: Mammalian expression systems (HEK293 or CHO cells) often provide better folding and post-translational modifications for human transmembrane proteins compared to bacterial systems.

  • Vector design considerations:

    • Include a cleavable tag (His, FLAG, or GST) for purification

    • Consider fusion partners that enhance solubility

    • Design constructs that exclude predicted signal peptides if appropriate

  • Induction and culture conditions:

    • For mammalian systems, reduce culture temperature to 30-32°C during expression

    • Use chemical chaperones like glycerol (5-10%) or DMSO (1-2%) to enhance proper folding

    • Consider tetracycline-inducible systems for temporal control of expression

  • Extraction and purification strategies:

    • Use mild detergents (DDM, CHAPS, or digitonin) for membrane protein solubilization

    • Perform affinity chromatography under conditions that maintain protein structure

    • Consider nanodiscs or amphipols for maintaining native-like environment during purification

What are the technical considerations for developing specific antibodies against TMEM221?

Developing specific antibodies against transmembrane proteins like TMEM221 requires careful antigen design and validation:

  • Antigen selection strategies:

    • Target extracellular loops or N/C-terminal domains that are likely accessible

    • Avoid highly conserved regions that could lead to cross-reactivity

    • Consider synthesizing peptides corresponding to unique epitopes (15-20 amino acids)

    • For polyclonal antibodies, use multiple peptides from different regions

  • Validation methods:

    • Confirm specificity using TMEM221 knockout cells as negative controls

    • Perform peptide competition assays to verify epitope specificity

    • Test cross-reactivity against related transmembrane proteins

    • Validate across multiple applications (western blot, immunofluorescence, immunoprecipitation)

  • Application-specific considerations:

    • For immunohistochemistry: Optimize fixation protocols to preserve epitope accessibility

    • For flow cytometry: Target extracellular domains

    • For western blotting: Consider sample preparation methods that avoid protein aggregation

How should researchers interpret TMEM221 expression data across different tissue types?

When analyzing TMEM221 expression across tissues, researchers should consider:

  • Reference gene selection: Transmembrane protein expression can vary significantly between tissues, so multiple reference genes should be used for normalization.

  • Tissue-specific factors: Consider that membrane protein extraction efficiency varies between tissues due to differences in lipid composition and extracellular matrix.

  • Data normalization approaches: Use geometric averaging of multiple reference genes rather than a single housekeeping gene, and consider tissue-specific normalization factors.

  • Statistical analysis: Apply appropriate statistical tests based on data distribution, and use multiple testing correction when comparing across numerous tissues.

  • Functional correlation: Correlate expression data with known tissue functions to generate hypotheses about potential roles of TMEM221.

  • Comparative analysis: Compare TMEM221 expression patterns with other transmembrane proteins that have known functions to identify potential functional relationships.

What bioinformatic approaches are most useful for predicting TMEM221 function?

Multiple bioinformatic approaches can provide insights into TMEM221 function:

  • Sequence-based analysis:

    • Predict transmembrane domains using TMHMM, Phobius, or MEMSAT

    • Identify functional motifs using PROSITE or ELM

    • Detect signal peptides using SignalP

  • Structural prediction:

    • Use AlphaFold or RoseTTAFold for 3D structure prediction

    • Apply molecular dynamics simulations to predict membrane interactions

  • Evolutionary analysis:

    • Perform phylogenetic analysis to identify conserved regions

    • Use selective pressure analysis to detect functionally important residues

  • Network-based approaches:

    • Predict protein-protein interactions using STRING or BioGRID

    • Perform gene co-expression network analysis using transcriptomic data

    • Identify pathway enrichment using Gene Ontology or KEGG databases

  • Integration of multi-omics data:

    • Correlate expression with proteomics and metabolomics data

    • Identify potential genetic interactions through GWAS data mining

What are the key considerations for designing CRISPR experiments targeting TMEM221?

When designing CRISPR experiments for TMEM221 research, consider:

  • Target selection:

    • Design sgRNAs targeting exonic regions that would cause frameshift mutations

    • Target conserved domains important for protein function

    • Avoid regions with known single nucleotide polymorphisms

    • Design multiple sgRNAs to increase knockout efficiency

  • Delivery method selection:

    • For primary cells or hard-to-transfect cells, AAV vector systems with saCas9 may provide better efficiency than plasmid transfection

    • Consider the cell type-specific tropism when selecting AAV serotypes

  • Control design:

    • Include non-targeting sgRNA controls

    • Consider using sgRNAs targeting non-essential genes as controls

    • For rescue experiments, design CRISPR-resistant TMEM221 constructs

  • Validation strategy:

    • Confirm editing efficiency through sequencing

    • Verify protein knockout through western blotting or immunofluorescence

    • Assess off-target effects through whole-genome sequencing or targeted sequencing of predicted off-target sites

How can TMEM221 CRISPR knockout systems be optimized for different cell types?

Optimizing TMEM221 CRISPR knockout systems for specific cell types requires:

  • Cell type-specific delivery optimization:

    • For primary cells: Use appropriate AAV serotypes or electroporation parameters

    • For dividing cells: Lentiviral delivery may be more efficient

    • For tissues: Consider local delivery methods or tissue-specific promoters

  • Expression system selection:

    • For constitutive knockout: Use strong promoters like CMV or CAG

    • For conditional knockout: Use inducible or tissue-specific promoters

    • For temporal control: Consider Tet-On/Off systems

  • Cell-specific validation methods:

    • Develop cell type-appropriate assays to confirm functional knockout

    • For difficult-to-transfect cells, use selection markers or flow cytometry to enrich for edited cells

    • For primary cells with limited lifespan, optimize timing for maximum editing efficiency

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.