Recombinant Human Transmembrane protein 222 (TMEM222)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment based on your requirements.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference for your preparation.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
TMEM222; C1orf160; Transmembrane protein 222
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-208
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
TMEM222
Target Protein Sequence
MAEAEGSSLLLLPPPPPPPRMAEVEAPTAAETDMKQYQGSGGVAMDVERSRFPYCVVWTP IPVLTWFFPIIGHMGICTSTGVIRDFAGPYFVSEDNMAFGKPAKYWKLDPAQVYASGPNA WDTAVHDASEEYKHRMHNLCCDNCHSHVALALNLMRYNNSTNWNMVTLCFFCLLYGKYVS VGAFVKTWLPFILLLGIILTVSLVFNLR
Uniprot No.

Target Background

Database Links

HGNC: 25363

KEGG: hsa:84065

STRING: 9606.ENSP00000363189

UniGene: Hs.469171

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is TMEM222 and what are its structural characteristics?

    TMEM222 (Transmembrane protein 222) is a protein encoded by the TMEM222 gene in humans. The protein contains three predicted transmembrane domains and a domain of unknown function (DUF778). The longest coding sequence (NM_032125.2, 1629 bp) encodes a protein of 208 amino acid residues with a molecular weight of 23230 daltons, considered the consensus coding sequence (CCDS297.2) . The TMEM222 protein is predicted to primarily localize to secretory vesicles, though research has specifically identified localization to early endosomes in neuronal synapses . There are two known isoforms of the TMEM222 protein; the isoforms are similar except the second isoform (Q9H0R3-2) lacks the first 96 amino acid residues that are present in the first isoform (Q9H0R3-1) . This structural organization suggests specialized membrane-associated functions that remain to be fully characterized.

  • What is the evolutionary conservation of TMEM222 across species?

    TMEM222 demonstrates remarkable evolutionary conservation across eukaryotic species, particularly in plants and animals, suggesting it plays a fundamental biological role. No paralogs have been identified in the human genome, indicating unique and essential functionality . The high degree of conservation, especially among mammals (>93% identity), points to strong selective pressure to maintain TMEM222's structure and function throughout evolution. This conservation provides valuable opportunities for developing animal models to study TMEM222 function.

    Genus/SpeciesCommon NameAccession NumberLengthSimilarityIdentity
    Rattus norvegicusRatNP_001107252.1208aa99%96%
    Canis familiarisDogXP_852505.1208aa98%96%
    Mus musculusMouseNP_079943.2208aa96%95%
    Sus scrofaPigXP_003127773.1208aa97%94%
    Equus caballusHorseXP_001917747.1207aa94%93%
    Gallus gallusChickenXP_417729.1182aa90%85%
    Danio rerioZebrafishNP_001013334.1174aa83%71%
    Anopheles gambiaeMosquitoXP_320483.3197aa66%53%
    Drosophila melanogasterFruit FlyNP_723362.1196aa74%61%
  • What is the tissue expression profile of TMEM222?

    TMEM222 exhibits a broad tissue expression profile with notably high expression levels. According to ACEVIEW database analysis, TMEM222 is highly expressed with 3.8 times greater expression than the average gene in the database . Expression evidence has been documented in 166 different tissues, including brain, lung, colon, kidney, and placenta. Within the brain, TMEM222 shows particularly high expression in the parietal and occipital cortex regions . This expression pattern correlates with its implicated role in neurodevelopment and function, providing valuable context for researchers designing tissue-specific experiments. When conducting expression analyses, researchers should consider this differential expression across brain regions when selecting appropriate controls and interpreting results. The widespread expression across multiple tissues also suggests possible functions beyond the nervous system that remain to be explored.

  • What clinical phenotypes are associated with TMEM222 gene variants?

    Biallelic variants in the TMEM222 gene have been identified as the cause of a novel autosomal recessive neurodevelopmental disorder. Clinical research involving 17 individuals from nine unrelated families revealed several consistent phenotypic features . The primary clinical presentation is intellectual disability, which appears to be the most consistent feature across affected individuals. Additional variable features include aggressive behavior, shy character, body tremors, decreased muscle mass in the lower extremities, and mild hypotonia. The identification of these features establishes TMEM222 as a gene essential for normal brain development and function, while the variability in additional symptoms suggests complex genotype-phenotype relationships that may depend on specific variant types, genetic background, and possibly environmental factors. These findings have significant implications for genetic counseling and highlight the importance of including TMEM222 in genetic screening panels for neurodevelopmental disorders.

Advanced Research Questions

  • What is the subcellular localization of TMEM222 and how does this inform its function?

    Subcellular localization studies using human neurons derived from induced pluripotent stem cells (iPSCs) have revealed that TMEM222 specifically localizes to early endosomes in the synapses of mature iPSC-derived neurons . This precise localization provides critical insights into potential functional roles. Early endosomes serve as primary sorting stations in the endocytic pathway, where internalized cargo is directed either toward recycling back to the plasma membrane or toward late endosomes and lysosomes for degradation. The presence of TMEM222 in early endosomes specifically at synapses suggests it may regulate protein trafficking critical for synaptic function, potentially affecting processes such as neurotransmitter receptor recycling, synaptic plasticity, or local protein turnover.

    For researchers investigating TMEM222 function, this localization pattern suggests focusing on endosomal trafficking pathways and synaptic protein dynamics. Methodologically, this can be further explored through co-localization studies with established markers of early endosomes (such as Rab5 or EEA1), live-cell imaging with fluorescently tagged TMEM222, immuno-electron microscopy for ultrastructural precision, and proximity labeling approaches to identify interacting proteins within the early endosomal compartment. The synaptic localization also highlights the importance of using neuronal models rather than generic cell lines when studying TMEM222 function.

  • What experimental approaches are most effective for studying TMEM222 function in neuronal models?

    Given the current understanding of TMEM222, several experimental approaches are particularly valuable for investigating its function in neuronal contexts:

    1. iPSC-derived neuronal models: These have proven effective for studying TMEM222 and offer the advantage of investigating human-specific aspects of function . Patient-derived iPSCs carrying TMEM222 variants can be differentiated into neurons to study pathological mechanisms compared to isogenic controls. Researchers can monitor multiple parameters including neuronal development, morphology, synaptic formation, and electrophysiological properties.

    2. CRISPR-Cas9 gene editing: CRISPR screens have included TMEM222, as indicated by BioGRID ORCS database entries . This technology allows precise genetic manipulation to:

      • Generate complete knockout models

      • Introduce specific patient variants for phenotype analysis

      • Create fluorescent protein fusions for dynamic visualization

      • Perform domain-specific mutagenesis to dissect functional regions

    3. Endosomal trafficking assays: Given TMEM222's localization to early endosomes, focused assays measuring endosomal dynamics provide direct functional insights:

      • Transferrin recycling kinetics as a measure of early endosome function

      • pH-sensitive fluorescent probes to track endosomal maturation

      • Receptor internalization and recycling studies focusing on synaptic proteins

      • Live imaging of endosomal components in TMEM222-deficient neurons

    4. Synaptic function measurements: To connect molecular function to neuronal physiology, researchers should employ:

      • Electrophysiological recordings to assess synaptic transmission

      • FM dye uptake/release assays for monitoring vesicle cycling

      • Synaptic proteome analysis with and without functional TMEM222

      • Activity-dependent studies to determine how neuronal stimulation affects TMEM222 function

    The combination of these approaches allows for comprehensive characterization of TMEM222 function from molecular to cellular to network levels.

  • How can researchers effectively detect and quantify TMEM222 expression in experimental systems?

    Detection and quantification of TMEM222 requires careful consideration of methodological approaches to ensure specificity and sensitivity. Based on published research methodologies, the following approaches are recommended:

    1. RNA-level detection:

      • Quantitative reverse transcription PCR (RT-qPCR) has been successfully used to characterize TMEM222 expression profiles across tissues and developmental stages . When designing RT-qPCR experiments, researchers should consider the two known isoforms and design primers that can either detect both isoforms or discriminate between them.

      • RNA-seq provides broader transcriptomic context and can reveal co-regulated genes

      • In situ hybridization offers spatial resolution in tissue sections, which is particularly valuable for analyzing brain region-specific expression

    2. Protein-level detection:

      • Western blotting with validated antibodies, ideally with TMEM222 knockout samples as negative controls

      • Immunohistochemistry/immunofluorescence for spatial information, though appropriate controls are crucial due to potential antibody cross-reactivity

      • Mass spectrometry for unbiased detection and absolute quantification

    3. Recombinant protein considerations:

      • For researchers working with recombinant TMEM222, epitope tagging (e.g., FLAG, HA, GFP) can facilitate detection and purification

      • Transmembrane proteins often express poorly, so optimization of expression conditions is essential

      • Consider using inducible expression systems to control expression levels and minimize toxicity

    When comparing TMEM222 levels across experimental conditions, absolute quantification using standard curves with recombinant protein provides more reliable results than relative quantification, particularly for low-abundance proteins.

  • What are the challenges and considerations when expressing recombinant TMEM222 for functional studies?

    Expressing recombinant transmembrane proteins like TMEM222 presents several technical challenges that researchers should address for successful functional studies:

    1. Expression system selection:

      • Mammalian expression systems (HEK293, CHO cells) best maintain native post-translational modifications and folding

      • Insect cells (Sf9, High Five) offer a compromise between yield and proper folding

      • Bacterial systems typically yield higher protein amounts but may lack proper folding, glycosylation, and membrane insertion

      • Cell-free systems can be useful for initial characterization but may not recapitulate all post-translational modifications

    2. Membrane protein solubilization:

      • TMEM222 has three transmembrane domains, requiring careful selection of detergents or lipid environments

      • Detergent screening is often necessary, starting with mild detergents like DDM, LMNG, or digitonin

      • Consider native nanodiscs or styrene-maleic acid lipid particles (SMALPs) to maintain the native lipid environment

      • Amphipols can improve stability after initial detergent extraction

    3. Fusion tags and their impact:

      • N-terminal vs. C-terminal tags may differentially affect function based on topology

      • Cleavable tags can help maintain native structure after purification

      • Consider tag size and location relative to transmembrane domains and known functional regions

      • Fluorescent protein fusions may alter trafficking or interaction properties

    4. Functional verification:

      • Given TMEM222's endosomal localization, verify correct trafficking in expression systems

      • Use complementation assays in knockout cellular models to confirm functionality

      • Consider proper controls for overexpression artifacts, such as non-physiological interactions or mislocalization

    The complexity of recombinant membrane protein expression necessitates thorough optimization and validation to ensure that the recombinant TMEM222 maintains native properties and functions.

  • How can researchers effectively model TMEM222-related neurodevelopmental disorders in laboratory settings?

    Modeling TMEM222-related neurodevelopmental disorders requires approaches that capture both molecular mechanisms and relevant phenotypes. Based on current knowledge, the following strategies are recommended:

    1. Patient-derived cellular models:

      • iPSCs from affected individuals differentiated into relevant neural cell types offer direct disease modeling

      • Isogenic controls using CRISPR correction of pathogenic variants provide matched genetic backgrounds

      • 3D organoid models can capture developmental aspects and cytoarchitecture not possible in 2D cultures

      • Single-cell sequencing can identify cell type-specific effects of TMEM222 variants

    2. Animal models:

      • Considering the high conservation of TMEM222 (95% identity in mice), rodent models with equivalent mutations may recapitulate aspects of the human condition

      • Key phenotypes to assess include:

        • Learning and memory deficits (Morris water maze, fear conditioning, novel object recognition)

        • Behavioral abnormalities (social interaction, repetitive behaviors, anxiety)

        • Neurological features (tremors, muscle tone, gait analysis)

        • Synaptic density and morphology

      • Developmental timepoints for analysis should be included based on expression patterns

    3. Functional readouts:

      • Synapse formation and function using electrophysiology and imaging

      • Endosomal trafficking dynamics with live cell imaging

      • Protein interaction networks using proteomics approaches

      • Transcriptional changes using RNA-seq to identify dysregulated pathways

    When designing these models, researchers should carefully consider the autosomal recessive inheritance pattern and aim to recapitulate the biallelic variant status observed in patients. Both loss-of-function and specific missense variants should be studied to understand genotype-phenotype correlations.

  • What are the emerging hypotheses regarding TMEM222's molecular function based on current evidence?

    Based on available evidence, several hypotheses about TMEM222's molecular function can be formulated, providing frameworks for focused experimental investigation:

    1. Endosomal trafficking regulator: Localization to early endosomes strongly suggests TMEM222 plays a role in endosomal functions . This could involve cargo sorting, membrane tubulation, vesicle budding, or interaction with trafficking machinery such as ESCRT complexes, Rab GTPases, or SNAREs. TMEM222 may specifically regulate the fate of endocytosed synaptic proteins, determining whether they are recycled back to the plasma membrane or targeted for degradation.

    2. Synaptic function modulator: The specific presence in neuronal synapses indicates potential roles in synaptic transmission or plasticity . This could involve:

      • Neurotransmitter receptor trafficking (e.g., AMPA, NMDA, GABA receptors)

      • Synaptic vesicle recycling at presynaptic terminals

      • Modulation of synaptic adhesion molecules during development or plasticity

      • Local protein synthesis regulation through endosomal signaling

    3. Neurodevelopmental regulator: The association with neurodevelopmental disorders suggests roles in processes critical for brain development , such as:

      • Neuronal migration or axon/dendrite development

      • Synaptogenesis and circuit formation

      • Activity-dependent refinement of connections

      • Cell-cell communication during critical developmental periods

    4. Potential transmembrane transporter: The presence of three transmembrane domains could form part of a channel or transport pathway. TMEM222 might transport specific ions, metabolites, or signaling molecules across the endosomal membrane, influencing endosomal maturation or signaling.

    These hypotheses provide valuable frameworks for experimental design. Researchers should develop assays that can distinguish between these possibilities and consider that TMEM222 may integrate multiple functions.

  • What approaches can be used to identify TMEM222 interaction partners and their functional significance?

    Identifying protein interaction partners is crucial for understanding TMEM222's molecular function. For comprehensive interaction mapping, researchers should consider these complementary approaches:

    1. Proximity-based labeling:

      • BioID or TurboID fusion proteins expressed in relevant cell types, particularly neurons

      • APEX2-based proximity labeling for temporal resolution during specific cellular events

      • These methods are particularly valuable for transmembrane proteins like TMEM222 and can capture transient or weak interactions within the native cellular environment

    2. Affinity purification-mass spectrometry (AP-MS):

      • Requires careful detergent selection to maintain membrane protein interactions

      • Crosslinking prior to lysis can capture transient interactions

      • Comparative analysis between wild-type TMEM222 and disease-causing variants can reveal pathologically relevant interaction changes

      • Quantitative approaches like SILAC or TMT labeling improve sensitivity for detecting changes

    3. Yeast two-hybrid screening:

      • Split-ubiquitin membrane yeast two-hybrid specifically designed for transmembrane proteins

      • Domain-specific baits to map interaction sites within TMEM222

      • Screening against brain-specific or neuron-specific libraries

    4. Validation strategies:

      • Co-immunoprecipitation in multiple cell types including neurons

      • FRET or BiFC for direct interaction verification in living cells

      • Mutational analysis of putative interaction interfaces

      • Functional assays to test biological relevance of identified interactions

    After identifying interaction partners, functional significance should be assessed through:

    • Disrupting specific interactions through targeted mutagenesis

    • Assessing effects on TMEM222 localization, stability, and function

    • Evaluating impact on neuronal development, morphology, and electrophysiology

    • Correlation of interaction strength with disease severity for different variants

    This systematic approach to interaction mapping will provide crucial insights into the molecular networks in which TMEM222 participates.

  • How does TMEM222 research integrate with broader understanding of endosomal function in neurons?

    TMEM222 research contributes to and draws from the broader field of endosomal biology in neurons, with several key integration points:

    1. Endosomal maturation and trafficking: Early endosomes, where TMEM222 localizes, are crucial sorting stations in neurons . Research should examine how TMEM222 affects:

      • Endosomal maturation timing and progression

      • Cargo sorting decisions between recycling and degradative pathways

      • Interaction with established regulators like Rab5, Rab11, and EEA1

      • Endosomal motility along neuronal processes

    2. Neuronal-specific endosomal processes: Neurons have specialized endosomal systems that differ from other cell types, including:

      • Synaptic vesicle recycling at presynaptic terminals

      • Activity-dependent receptor trafficking at postsynaptic sites

      • Polarized trafficking in axons versus dendrites

      • Local endosomal sorting at distal synapses

      TMEM222's specific role in these neuron-specific processes remains to be fully characterized.

    3. Links to other neurodevelopmental disorders: Several endosomal proteins are implicated in neurodevelopmental disorders, including PRICKLE, SORT1, and components of the ESCRT machinery. Comparative analysis of phenotypes and mechanisms can reveal common pathways and points of convergence, potentially leading to shared therapeutic strategies.

    4. Signaling functions of endosomes: Beyond trafficking, endosomes serve as signaling platforms where receptor-ligand complexes continue to signal after internalization. TMEM222 may influence the duration or intensity of such signaling events, particularly those relevant to neuronal development or synaptic plasticity.

    Researchers should position their TMEM222 studies within this broader context of neuronal endosomal biology, both to leverage existing knowledge and to contribute to the field's understanding of how endosomal dysfunction contributes to neurodevelopmental disorders.

  • What are the key methodological considerations for genotyping and variant analysis of TMEM222?

    Comprehensive genetic analysis of TMEM222 requires careful methodological approaches to ensure accurate variant detection and interpretation:

    1. Sequencing strategies:

      • Whole exome sequencing has successfully identified pathogenic TMEM222 variants in affected individuals

      • Targeted next-generation sequencing panels including TMEM222 provide cost-effective options for clinical testing

      • Consider including coverage for non-coding regulatory regions in comprehensive research analyses

      • Ensure adequate depth of coverage across all TMEM222 exons and splice sites

    2. Variant detection sensitivity:

      • Commercial genetic testing reports >99% sensitivity for sequence variants and copy number variants within TMEM222

      • Deep sequencing (>100x coverage) improves detection of low-frequency variants

      • Consider specialized approaches for complex regions or variant types:

        • Long-read sequencing for structural variants

        • RNA sequencing to detect splicing abnormalities

        • Methylation analysis for epigenetic alterations

    3. Variant interpretation:

      • Follow ACMG/AMP guidelines for variant classification

      • Consider the autosomal recessive inheritance pattern when evaluating variants

      • Assess conservation at variant sites using multiple sequence alignments

      • Utilize in silico prediction tools while recognizing their limitations

      • Functional studies may be necessary for variants of uncertain significance (VUS)

    4. Copy number analysis:

      • Include methods to detect deletions/duplications affecting TMEM222

      • Use multiple algorithms for CNV calling from sequencing data

      • Validate putative CNVs with orthogonal methods (e.g., MLPA, qPCR, array CGH)

      • Determine exact breakpoints when possible to understand mechanism

    For novel variants, functional assays examining protein localization, stability, interaction partners, and endosomal function can provide valuable evidence for variant interpretation and classification.

  • What techniques are most effective for studying TMEM222 in the context of synaptic function?

    Given TMEM222's localization to synapses, specialized techniques for studying synaptic function provide crucial insights:

    1. High-resolution imaging approaches:

      • Super-resolution microscopy (STORM, PALM, STED) to precisely localize TMEM222 within synaptic structures

      • Live imaging with pH-sensitive fluorescent proteins (pHluorins) to track dynamics during synaptic activity

      • Correlative light and electron microscopy for ultrastructural context

      • Expansion microscopy to visualize nanoscale organization within synapses

    2. Functional electrophysiology:

      • Patch-clamp recordings to measure synaptic transmission properties:

        • Miniature excitatory/inhibitory postsynaptic currents (mEPSCs/mIPSCs) for spontaneous release

        • Evoked responses to assess action potential-driven transmission

        • Paired-pulse facilitation/depression to examine presynaptic release probability

      • Multi-electrode arrays for network-level activity assessment

      • Paired recordings between connected neurons to assess specific synaptic connections

    3. Optical methods for synaptic activity:

      • Calcium imaging using genetically encoded calcium indicators (GCaMPs)

      • Neurotransmitter sensors (e.g., GluSnFR, iGABASnFR) for direct visualization of release

      • Synaptophysin-pHluorin or synaptotagmin-pHluorin for tracking vesicle fusion events

      • FM dye uptake/release for measuring synaptic vesicle cycling

    4. Molecular and biochemical approaches:

      • Synaptic fractionation to isolate and analyze protein composition

      • Proximity labeling specifically targeted to synaptic compartments

      • Activity-dependent tagging to capture proteins mobilized during stimulation

      • Quantitative proteomics of synaptic fractions with and without TMEM222

    5. Perturbation approaches:

      • Acute protein inactivation using techniques like auxin-inducible degron or CRISPR-SNIPR

      • Optogenetic control of TMEM222 localization or activity

      • Targeted disruption of specific TMEM222 domains or interactions

    These complementary approaches should be adapted to address specific research questions about TMEM222's role in synaptic development, maintenance, or plasticity.

  • What are the current gaps in TMEM222 research and promising future directions?

    Despite recent advances in understanding TMEM222, several knowledge gaps remain that represent promising research opportunities:

    1. Structural characterization: No high-resolution structures of TMEM222 are currently available. Structural studies using techniques like cryo-electron microscopy or X-ray crystallography would provide insights into:

      • Molecular mechanism of action

      • How disease-causing variants disrupt structure or function

      • Potential binding sites for developing therapeutic compounds

      • Topology and organization of transmembrane domains

    2. Precise molecular function: The specific role of TMEM222 in endosomes remains incompletely defined. Key questions include:

      • What specific cargo proteins are affected by TMEM222?

      • Does TMEM222 have enzymatic activity or serve as an adaptor protein?

      • What signaling pathways are directly affected by TMEM222 dysfunction?

      • Is TMEM222 involved in membrane remodeling, fusion, or fission?

    3. Developmental significance: While TMEM222 variants cause neurodevelopmental disorders, the specific developmental processes affected require further investigation:

      • Critical periods for TMEM222 function during brain development

      • Temporal expression patterns across developmental stages

      • Region-specific requirements in the developing brain

      • Potential for therapeutic interventions at different developmental stages

    4. Physiological regulation: How TMEM222's activity and localization are regulated under normal conditions remains unclear:

      • Post-translational modifications affecting function

      • Activity-dependent regulation at synapses

      • Turnover and degradation mechanisms

      • Factors controlling expression levels

    5. Therapeutic development: No targeted therapies for TMEM222-related disorders currently exist. Promising approaches include:

      • Gene replacement or editing strategies

      • Small molecule modulators of affected endosomal pathways

      • Targeting downstream effectors of TMEM222 dysfunction

      • Repurposing existing drugs that modulate endosomal function

    These areas represent significant opportunities for researchers to make novel contributions to understanding TMEM222 biology and developing potential therapeutic approaches for associated neurodevelopmental disorders.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.