Recombinant Human Transmembrane protein 225 (TMEM225)

Shipped with Ice Packs
In Stock

Description

Expression and Subcellular Localization

TMEM225 exhibits testis-specific expression and stage-dependent localization:

  • Tissue Specificity: Exclusively expressed in testes across species, with mRNA detected in spermatocytes and round spermatids .

  • Cellular Localization: In rodents, TMEM225 surrounds the nuclear membrane and cytoplasm in germ cells . Post-acrosome reaction, it localizes to the equatorial segment of sperm .

Functional Insights from Animal Models

Knockout (KO) studies in mice reveal critical roles in sperm maturation and fertility:

  • Fertility Defects: Tmem225 KO males are infertile due to asthenospermia (reduced motility) and abnormal sperm morphology (hairpin-loop flagella) .

  • Mechanisms:

    • Mitochondrial Dysfunction: KO sperm show elevated reactive oxygen species (ROS) and impaired glycolytic pathways .

    • Flagellar Defects: Disrupted protein networks affecting flagellar structure (e.g., tubulin, SPATA3) .

Table 2: Proteomic Alterations in Tmem225 KO Sperm

Pathway AffectedKey Proteins Dysregulated
Mitochondrial FunctionCOX5B, NDUFS1, ATP5F1
GlycolysisLDHC, PGK2, GAPDHS
Flagellar MorphologyTUBB, SPATA3, CABYR

Interaction with PP1γ2 and Signaling Regulation

TMEM225 regulates serine/threonine phosphatase PP1γ2 via its RVxF motif:

  • Binding: The C-terminal region of TMEM225 interacts with PP1γ2, inhibiting its activity in vitro .

  • Functional Impact: This interaction may modulate spermatogenesis, capacitation, and motility .

Clinical Relevance in Human Male Infertility

TMEM225 is implicated in nonobstructive azoospermia (NOA):

  • Patient Data: Abnormal TMEM225 levels correlate with NOA, suggesting diagnostic or therapeutic potential .

  • Research Tools: Recombinant human TMEM225 could enable studies on PP1γ2 regulation and sperm maturation pathways.

Applications of Recombinant Human TMEM225

While recombinant human TMEM225 is not yet commercially available, its potential uses include:

  • Antibody Development: Peptides from conserved regions (e.g., C-terminal VTWAL) generate antibodies for infertility diagnostics .

  • Functional Studies: Structural domains (e.g., transmembrane helices) can be expressed to analyze membrane topology and protein interactions .

Key Unanswered Questions and Future Directions

  1. Human-Specific Mechanisms: How do structural differences between human and rodent TMEM225 affect function?

  2. Therapeutic Targeting: Can modulating TMEM225-PP1γ2 interactions rescue sperm defects?

  3. Biochemical Characterization: Detailed structural analysis (e.g., cryo-EM) of recombinant human TMEM225 is needed.

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery estimates.
Important: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors such as storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us. We will prioritize the development of the specified tag if feasible.
Synonyms
TMEM225; PMP22CD; Transmembrane protein 225
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-225
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
TMEM225
Target Protein Sequence
MVHVSNRSIQGMNILFSSWAVVLMVMGITLDKWVELISEDERAKMNHSPWMMCCPALWPE DDLKVVRIMMTSSLGLSFLLNLILGMKFTYLIPQNKYIQLFTTILSFFSGISLLWALILY HNKLKQGQSMHFSNYRITWIMYTAYLNVFFLSVCGVLSLLECKLSTSSCTCLNIHKSDNE CKESENSIEDISLPECTAMPRSIVRAHTVNSLNKKVQTRHVTWAL
Uniprot No.

Target Background

Function
TMEM225 likely inhibits protein phosphatase 1 (PP1) in sperm by binding to the catalytic subunit PPP1CC.
Database Links

HGNC: 32390

KEGG: hsa:338661

STRING: 9606.ENSP00000364166

UniGene: Hs.98377

Subcellular Location
Cytoplasmic vesicle, secretory vesicle, acrosome membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of human TMEM225?

TMEM225 contains an open reading frame with a length of 696 bp, encoding a protein with four putative transmembrane helices. The protein contains an RVxF motif, which serves as a consensus binding site for serine/threonine protein phosphatase 1 (PP1). Structural prediction analysis reveals that TMEM225 is composed of four alpha-helical transmembrane domains (TM-1, TM-2, TM-3, and TM-4) of 20, 23, 20, and 20 amino acids, respectively, with N- and C-terminal cytoplasmic domains of 10 and 71 amino acids . The protein also contains two intracellular loops of 39 and 20 amino acids, and a short extracellular loop of 8 amino acids .

How conserved is TMEM225 across species?

TMEM225 is highly conserved across multiple species, particularly in mammals. Sequence analysis shows that rat TMEM225 shares significant homology with orthologs in human (43% identity and 64% similarity), chimpanzee (44% identity and 64% similarity), mouse (83% identity and 91% similarity), and other mammals . The conservation includes six serine residues and seven leucine residues that are highly preserved across all species examined. Additionally, two specific amino acid blocks (PRSIV and VTWAL) are notably conserved in the C-terminus region . This high degree of conservation suggests functional importance of this protein throughout mammalian evolution.

How can researchers predict transmembrane topology of TMEM225?

The transmembrane topology of TMEM225 can be predicted using specialized software such as HMMTOP. Methodologically, researchers should begin with the complete amino acid sequence and apply multiple prediction algorithms to establish consensus. Current analysis indicates that the N-terminus is positioned outside the membrane, the first loop of TMEM225 is longer than the second one, and the protein features a very short N-terminus tail with a more than 71-residue-long C-terminus . For experimental verification of these predictions, researchers should consider using epitope tagging at different termini followed by selective permeabilization techniques or protease protection assays to confirm the orientation of different protein domains.

What is the tissue-specific expression pattern of TMEM225?

TMEM225 expression is highly specific to testicular germ cells, with no detectable expression in other examined tissues including lung, liver, ovary, spleen, heart, kidney, and skeletal muscle . This specificity makes it a potentially valuable marker for testicular tissue research. Expression levels increase during spermatogenesis, suggesting developmental regulation . To study this tissue-specific expression, researchers should employ RT-PCR with carefully designed primers spanning exon-exon junctions to avoid genomic DNA amplification, and confirm with Northern blotting or RNA-seq for quantitative analysis.

Is there age-dependent expression of TMEM225?

Yes, TMEM225 demonstrates notable age-dependent expression patterns. In rats, TMEM225 expression is specifically elevated during the adult period after the age of 13 months . This age-related expression pattern is distinct from many developmental genes expressed during early spermatogenesis. The timing suggests that TMEM225 may be more involved in sperm degeneration rather than initial spermatogenesis processes . Researchers investigating age-related changes in fertility should include multiple age points in their experimental design, particularly including specimens beyond reproductive prime.

What is the subcellular localization of TMEM225?

TMEM225 shows a distinctive subcellular localization pattern. In mature spermatozoa, TMEM225 is specifically localized to the equatorial segment of the acrosome but is absent from the midpiece and tail regions . It appears to be an outer and/or inner acrosomal membrane protein that is lost from the dorsal region of the acrosome after the acrosome reaction . In cellular studies using GFP fusion proteins, TMEM225 predominantly concentrates around the nuclear membrane, with some granular distribution in the cytoplasm . Notably, TMEM225 is not typically detected in the cell membrane, contrary to what might be expected for many transmembrane proteins .

What are the known protein interactions of TMEM225?

TMEM225 has been demonstrated to interact with protein phosphatase 1 (PP1) in vivo . Specifically, pull-down assays have revealed that the carboxy-terminal region of TMEM225 can bind to PP1γ2, which is the predominant isoform of PP1 in male germ cells . This interaction occurs via the RVxF motif present in TMEM225 . To study such interactions, researchers should employ co-immunoprecipitation or pull-down assays using tagged recombinant proteins, followed by mass spectrometry to identify additional interacting partners. Yeast two-hybrid screening can also be valuable for identifying novel protein interactions.

How does TMEM225 affect PP1γ2 activity?

TMEM225 acts as an inhibitor of PP1γ2 activity in vitro through its RVxF motif . This inhibitory function suggests that TMEM225 may regulate PP1γ2-dependent processes in spermatozoa. Methodologically, researchers can assess this inhibitory effect using phosphatase activity assays with purified components. Site-directed mutagenesis of the RVxF motif should abolish this inhibitory effect, providing a valuable negative control. The physiological significance of this inhibition can be studied through temporal correlation of TMEM225 expression with PP1γ2 activity levels during spermatogenesis and sperm maturation.

What functional role does TMEM225 play in reproduction?

Evidence suggests that TMEM225 is involved in the differentiation and function of spermatozoa through the regulation of PP1γ2 activity . PP1γ2 activity is necessary for normal spermatogenesis as well as spermatozoa capacitation and motility . Some research suggests that TMEM225 may play a role in sperm degeneration rather than early spermatogenesis, based on its expression pattern being unrelated to the first wave of spermatozoon development . To investigate these functional roles, researchers should consider conditional knockout models, ideally with temporally controlled gene deletion to distinguish between developmental and maintenance functions.

What techniques are effective for studying TMEM225 mRNA expression?

Several complementary techniques are effective for studying TMEM225 mRNA expression:

  • RT-PCR: Using primers TMEM225-F (5′-ATA AAG TTA CCC ACA GTC C-3′) and TMEM225-R (5′-TCA TTG CTT TGC TGC TAC-3′) under conditions of 94°C for 2 min, followed by 35 cycles of 30 s at 94°C, 30 s at 52°C, and 40 s at 72°C, with a final extension of 5 min at 72°C .

  • In situ hybridization: This technique is particularly valuable for determining cellular localization of mRNA expression. Short oligonucleotide probes are recommended for better tissue penetration, with multiple probes to strengthen signals . The sequences used successfully in previous research are:

    • 5′-CCA CAG TCC ATG GCT GGG ATG CTG TCC TCC TTT-3′

    • 5′-GCA GTT CAC CTA CAT GAT TTC TCA AAA TAA GTG TG-3′

    • 5′-AAC AGA TGT GCG TGC ATG AAA TTC TGT GTA CCC CA-3′

  • Quantitative PCR: For precise quantification of expression levels across development or in different conditions.

How can the subcellular localization of TMEM225 be determined experimentally?

Subcellular localization can be determined using:

  • GFP fusion proteins: By creating recombinant constructs where TMEM225 is fused to GFP, researchers can visualize its localization in live cells. The pEGFP-TMEM225 construct can be generated using PCR with forward (5′-ATC TCG AGC AAT GAT GCG CAT TCC-3′) and reverse (5′-ATG AAT TCA GTC ACA GAG CCC AGG-3′) primers .

  • Domain deletion studies: Creating N-terminal truncated versions (such as pEGFP-D35-TMEM225) helps determine the role of specific domains in localization .

  • Immunofluorescence: Using specific antibodies against TMEM225 in fixed cells or tissues, combined with markers for different cellular compartments.

  • Subcellular fractionation: Physical separation of cellular components followed by Western blotting can biochemically confirm localization patterns.

What approaches should be used to study the effect of TMEM225 on PP1γ2 activity?

To study TMEM225's effect on PP1γ2 activity, researchers should:

  • In vitro phosphatase assays: Using purified recombinant PP1γ2 with and without TMEM225, measure phosphatase activity against standard substrates like phosphorylase a.

  • Site-directed mutagenesis: Create TMEM225 variants with mutations in the RVxF motif to confirm the specificity of the interaction and inhibition.

  • Cellular systems: Express wild-type or mutant TMEM225 in cellular models and assess endogenous PP1 activity using phospho-specific antibodies against known PP1 substrates.

  • Co-immunoprecipitation: To confirm the physical interaction between TMEM225 and PP1γ2 in cellular contexts.

  • Biophysical methods: Surface plasmon resonance or isothermal titration calorimetry to determine binding kinetics and affinity between TMEM225 and PP1γ2.

How might post-translational modifications affect TMEM225 function?

The highly conserved serine residues in TMEM225 across species suggest potential regulatory phosphorylation sites . Given TMEM225's interaction with a phosphatase (PP1γ2), there may be a regulatory feedback mechanism involving phosphorylation/dephosphorylation cycles. Researchers should investigate:

  • Mass spectrometry analysis of purified TMEM225 to identify phosphorylation sites

  • Phospho-mimetic mutants (serine to aspartate) and phospho-null mutants (serine to alanine) to determine functional consequences

  • Temporal correlation between TMEM225 phosphorylation status and its inhibitory activity on PP1γ2

  • Identification of kinases potentially responsible for TMEM225 phosphorylation

The dynamic changes in TMEM225 after the acrosome reaction may involve post-translational modifications that should be systematically investigated.

What are the challenges in expressing recombinant TMEM225 for structural studies?

As a multi-transmembrane protein, TMEM225 presents several challenges for recombinant expression:

  • Membrane protein folding: The four transmembrane domains require proper membrane environments to fold correctly. Expression systems such as insect cells or mammalian cells may be necessary instead of bacterial systems.

  • Importance of N-terminal domain: Research shows the N-terminal region affects localization , suggesting it may be critical for proper folding. Any expression construct should maintain this domain intact.

  • Purification strategies: Detergent screening is essential for extracting properly folded TMEM225 from membranes. Mild detergents like DDM or LMNG may be suitable starting points.

  • Structural analysis options: Cryo-EM may be more suitable than crystallography for TMEM225, particularly when captured in complex with PP1γ2.

  • Functional validation: Any recombinant protein should be validated for PP1γ2 binding and inhibition before proceeding to structural studies.

How should researchers design TMEM225 knockout or knockdown experiments?

When designing TMEM225 knockout or knockdown experiments, researchers should consider:

  • Tissue-specific expression: Given TMEM225's testis-specific expression , conditional knockout approaches targeting germ cells are necessary to avoid potential developmental effects.

  • Age-dependent considerations: The age-related expression pattern means experiments should be designed to assess effects across multiple age points, particularly in older animals.

  • Temporal control: Inducible systems (like tamoxifen-inducible Cre) would allow distinction between developmental roles and maintenance functions in adult tissues.

  • Molecular validation: Verification of knockout efficiency through RT-PCR, Western blotting, and in situ hybridization.

  • Phenotypic assessment: Comprehensive evaluation of spermatogenesis, sperm morphology, motility, capacitation, and fertility in knockout models.

  • Rescue experiments: Reintroduction of wild-type or mutant TMEM225 to confirm specificity of observed phenotypes.

  • Molecular consequences: Assessment of PP1γ2 activity and phosphorylation status of downstream substrates in knockout tissues.

What is known about the genomic organization of TMEM225?

TMEM225 has been mapped to rat chromosome 8q22 and is composed of four exons and three introns . The genomic structure is summarized in the following table:

3′ Splice acceptorExonSize (bp)5′ Splice donorIntronSize (bp)
cDNA end CGACGCTCCG1299TGGCCTGAAG gtcagaacta1684
ttcccaac agAGAGCCTGGA2147TTCTTCACAG gtagcttcct2270
tgaacact agGTTGCCTTTT3135CTTACCTGTG gtaagtatcc3695
ctgtccct agGTATCTTCAG4329GGAAAGATTC aaaaaaaaaPolyA

The open reading frame spans from nucleotides 119 to 814, with the ATG start codon (nucleotides 119–121) preceded by an in-frame stop codon TAG . Interestingly, TMEM225 is located in close proximity to a cluster of 41 olfactory receptor genes (Olr1301 to Olr1341) on rat chromosome 8q22 , which may have evolutionary significance.

How should researchers approach translating findings from animal models to human TMEM225?

When translating findings from animal models to human TMEM225, researchers should:

  • Consider sequence homology: Human TMEM225 shares only 43% identity and 64% similarity with rat TMEM225 , which may result in functional differences.

  • Focus on conserved domains: The highly conserved amino acid blocks (PRSIV and VTWAL) in the C-terminus and the RVxF motif are likely to maintain similar functions across species .

  • Compare expression patterns: Verify whether the testis-specific and age-dependent expression patterns observed in rodents are conserved in human tissues.

  • Validate protein interactions: Confirm whether human TMEM225 similarly interacts with and inhibits human PP1γ2.

  • Employ human cell models: Use human testicular cell lines or primary cultures when available to validate findings from animal studies.

  • Consider clinical correlations: Explore possible associations between TMEM225 variants and male fertility issues in human populations.

  • Apply comparative genomics: Analyze synteny and evolutionary conservation of the genomic locus across species for additional insights.

Human, rodent, and other mammalian systems should be used complementarily to build a comprehensive understanding of TMEM225 function in reproduction.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.